CTSG (cathepsin G)

Gene

• Entrez ID: 1511
• Gene name: Cathepsin G
• Gene symbol: CTSG
• Synonyms (NCBI Gene): CATG, CG
• Chromosome: 14
• Chromosome location: 14q12
• Summary: The protein encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in th

Transcription factors

Transcription factor	Regulation	Reference
CEBPE	Unknown	16019164
MYB	Unknown	16019164
SPI1	Unknown	16019164

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002003	Process	Angiotensin maturation	TAS
GO:0002548	Process	Monocyte chemotaxis	IDA	15210802
GO:0004252	Function	Serine-type endopeptidase activity	EXP	10512690
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	8194606, 12504904, 15100291
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	3390156, 29077095, 32144329
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	11259672
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IDA	15100291
GO:0005764	Component	Lysosome	IEA
GO:0005829	Component	Cytosol	IDA	29077095
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	1861080
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	IDA	8573071
GO:0006508	Process	Proteolysis	IDA	11907569
GO:0006508	Process	Proteolysis	IDA	1861080, 11259672, 15100291, 32144329
GO:0006508	Process	Proteolysis	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006955	Process	Immune response	TAS	2569462
GO:0008201	Function	Heparin binding	IDA	11907569
GO:0008233	Function	Peptidase activity	IDA	11907569
GO:0008233	Function	Peptidase activity	IEA
GO:0008233	Function	Peptidase activity	TAS
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IMP	1937776
GO:0010494	Component	Cytoplasmic stress granule	IDA	1937776
GO:0016020	Component	Membrane	IDA	29077095
GO:0016020	Component	Membrane	IEA
GO:0016485	Process	Protein processing	IDA	7744748, 16963625, 22879591, 30804664
GO:0016787	Function	Hydrolase activity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019731	Process	Antibacterial humoral response	IDA	1937776
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030141	Component	Secretory granule	IDA	11907569
GO:0030168	Process	Platelet activation	IDA	10702240
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	25037231, 27559042, 28344315, 28675934
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0035590	Process	Purinergic nucleotide receptor signaling pathway	TAS
GO:0042119	Process	Neutrophil activation	IDA	22879591
GO:0042742	Process	Defense response to bacterium	IEA
GO:0048018	Function	Receptor ligand activity	IDA	15210802
GO:0050778	Process	Positive regulation of immune response	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	1937776, 2116408
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	2116408, 2117044
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050832	Process	Defense response to fungus	IEA
GO:0050868	Process	Negative regulation of T cell activation	IDA	15100291
GO:0051604	Process	Protein maturation	IBA
GO:0051604	Process	Protein maturation	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070946	Process	Neutrophil-mediated killing of gram-positive bacterium	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	1937776
GO:0089720	Function	Caspase binding	IPI	29077095
GO:0098786	Process	Biofilm matrix disassembly	IDA	32995850
GO:1901731	Process	Positive regulation of platelet aggregation	IDA	3390156

Other IDs

• MIM: 116830
• HGNC: 2532
• e!Ensembl: ENSG00000100448

Protein

• UniProt ID: P08311
• Protein name: Cathepsin G (CG) (EC 3.4.21.20) [Cleaved into: Cathepsin G, C-terminal truncated form]
• Protein function: Serine protease with trypsin- and chymotrypsin-like specificity (PubMed:29652924, PubMed:8194606). Also displays antibacterial activity against Gram-negative and Gram-positive bacteria independent of its protease activity (PubMed:2116408, PubMed
• PDB: 1AU8, 1CGH, 1KYN, 1T32, 6VTM, 7H6G, 7H6H, 8D4S, 8D4V, 8D7I, 8D7K, 8G24, 8G25, 8G26, 9ASX, 9ATK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	21 → 238	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in neutrophils (at protein level) (PubMed:3799965). Expressed in B cells (PubMed:15100291). {ECO:0000269|PubMed:15100291, ECO:0000269|PubMed:3799965}.
• Sequence:

  MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
  TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
  NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
  PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
  TMRSFKLLDQMETPL

• Sequence length: 255

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Lysosome
Neutrophil extracellular trap formation
Renin-angiotensin system
Amoebiasis
Systemic lupus erythematosus

Reactome:

Degradation of the extracellular matrix
Activation of Matrix Metalloproteinases
Metabolism of Angiotensinogen to Angiotensins
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Interleukin-1 processing
Neutrophil degranulation
Antimicrobial peptides
Suppression of apoptosis
Purinergic signaling in leishmaniasis infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma	Associate	34133324	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	34745015	★☆☆☆☆ Found in Text Mining only
Adrenal Cortex Diseases	Associate	30924919	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	8344949	★☆☆☆☆ Found in Text Mining only
Arthritis	Associate	2156847	★☆☆☆☆ Found in Text Mining only
Arthritis	Stimulate	40270010	★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Stimulate	37069596	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	32650679	★☆☆☆☆ Found in Text Mining only
Asthma	Stimulate	19159017	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	32460303, 33878997	★☆☆☆☆ Found in Text Mining only
Blister	Associate	22991566	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Associate	31647805	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Stimulate	19965623	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	28544544, 36450530	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Associate	9493662	★☆☆☆☆ Found in Text Mining only
Burning Mouth Syndrome	Associate	28326926	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	37151875	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Associate	2654297	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	37118737	★☆☆☆☆ Found in Text Mining only
Chediak Higashi Syndrome	Associate	2841356	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Inhibit	37151875	★☆☆☆☆ Found in Text Mining only
Cutis Laxa	Associate	7930686	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	12204095	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Associate	22991566	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	35058920	★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Inhibit	36450530	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Associate	39343172	★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Associate	24468662	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Associate	29201909	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	26837514	★☆☆☆☆ Found in Text Mining only
Glucosephosphate Dehydrogenase Deficiency	Associate	8730284	★☆☆☆☆ Found in Text Mining only
Hypertension	Inhibit	29512095	★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	36450530	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Associate	22761659	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	12204095, 16019164, 2156847, 31647805	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	29777136	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Neoplasms	Associate	32472950	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Associate	30429499	★☆☆☆☆ Found in Text Mining only
Keratosis palmoplantaris with periodontopathia and onychogryposis	Associate	31557781	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	38128610	★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	15958635	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	9058723	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	23147993	★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic B Cell	Associate	9058723	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Associate	16019164	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Associate	19241385	★☆☆☆☆ Found in Text Mining only
Mitral Valve Insufficiency	Associate	30581499	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis II	Associate	24083598	★☆☆☆☆ Found in Text Mining only
Mycoses	Associate	15585850	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	2305832, 28544544, 34745015, 7747813	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	37151875	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Associate	32472950	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Associate	31647805	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	15958635	★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Associate	24454890	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	12645829, 22852767	★☆☆☆☆ Found in Text Mining only
Refsum Disease Infantile	Associate	8730284	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	35488327	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	34229539	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	32579540	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	39224598	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Stimulate	19965623	★☆☆☆☆ Found in Text Mining only
Zellweger Syndrome	Associate	8730284	★☆☆☆☆ Found in Text Mining only