Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	151056
Gene name Gene Name - the full gene name approved by the HGNC.	Phospholipase B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PLB1
Synonyms (NCBI Gene) Gene synonyms aliases	PLB, PLB/LIP
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p23.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a membrane-associated phospholipase that displays lysophospholipase and phospholipase A2 activities through removal of sn-1 and sn-2 fatty acids of glycerophospholipids. In addition, it displays lipase and retinyl ester hydrolase activit

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments
MIRT1239483	hsa-miR-1224-5p	CLIP-seq
MIRT1239484	hsa-miR-2909	CLIP-seq
MIRT1239485	hsa-miR-4267	CLIP-seq
MIRT1239486	hsa-miR-4710	CLIP-seq
MIRT1239487	hsa-miR-4751	CLIP-seq
MIRT1239488	hsa-miR-4790-3p	CLIP-seq
MIRT1239489	hsa-miR-711	CLIP-seq
MIRT2070444	hsa-miR-1269	CLIP-seq
MIRT2070445	hsa-miR-1269b	CLIP-seq
MIRT2070446	hsa-miR-4529-3p	CLIP-seq
MIRT2392624	hsa-miR-1287	CLIP-seq
MIRT2392625	hsa-miR-1827	CLIP-seq
MIRT2392626	hsa-miR-1972	CLIP-seq
MIRT2392627	hsa-miR-3135b	CLIP-seq
MIRT2392628	hsa-miR-3173-5p	CLIP-seq
MIRT2392629	hsa-miR-3612	CLIP-seq
MIRT2392630	hsa-miR-370	CLIP-seq
MIRT2392631	hsa-miR-4443	CLIP-seq
MIRT2392632	hsa-miR-4717-5p	CLIP-seq
MIRT2392633	hsa-miR-650	CLIP-seq
MIRT2392634	hsa-miR-940	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
HIRA	Repression	9809417

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	TAS
GO:0004620	Function	Phospholipase activity	IEA
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IBA
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IEA
GO:0004623	Function	Phospholipase A2 activity	IBA
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0004623	Function	Phospholipase A2 activity	TAS
GO:0004806	Function	Triacylglycerol lipase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IBA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016298	Function	Lipase activity	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016788	Function	Hydrolase activity, acting on ester bonds	IEA
GO:0019433	Process	Triglyceride catabolic process	IEA
GO:0031526	Component	Brush border membrane	IBA
GO:0031526	Component	Brush border membrane	IEA
GO:0034478	Process	Phosphatidylglycerol catabolic process	IEA
GO:0034638	Process	Phosphatidylcholine catabolic process	IEA
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	TAS
GO:0042572	Process	Retinol metabolic process	IEA
GO:0046338	Process	Phosphatidylethanolamine catabolic process	IEA
GO:0046340	Process	Diacylglycerol catabolic process	IEA
GO:0047499	Function	Calcium-independent phospholipase A2 activity	IEA
GO:0050253	Function	Retinyl-palmitate esterase activity	IBA
GO:0050253	Function	Retinyl-palmitate esterase activity	IEA
GO:0050253	Function	Retinyl-palmitate esterase activity	TAS
GO:2000344	Process	Positive regulation of acrosome reaction	IEA

MIM	HGNC	e!Ensembl
610179	30041	ENSG00000163803

Protein

UniProt ID

Q6P1J6

Protein name

Phospholipase B1, membrane-associated (Phospholipase B) (hPLB) (Lysophospholipase) (EC 3.1.1.5) (Phospholipase A2) (EC 3.1.1.4) (Phospholipase B/lipase) (PLB/LIP) (Triacylglycerol lipase) (EC 3.1.1.3)

Protein function

Calcium-independent membrane-associated phospholipase that catalyzes complete diacylation of phospholipids by hydrolyzing both sn-1 and sn-2 fatty acyl chains attached to the glycerol backbone (phospholipase B activity) (By similarity). Has dual

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00657	Lipase_GDSL	394 → 668	GDSL-like Lipase/Acylhydrolase	Family
PF00657	Lipase_GDSL	741 → 1015	GDSL-like Lipase/Acylhydrolase	Family
PF00657	Lipase_GDSL	1097 → 1362	GDSL-like Lipase/Acylhydrolase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the epidermis (at protein level). {ECO:0000269|PubMed:12150957}.

Sequence

MGLRPGIFLLELLLLLGQGTPQIHTSPRKSTLEGQLWPETLKNSPFPCNPNKLGVNMPSK
SVHSLKPSDIKFVAAIGNLEIPPDPGTGDLEKQDWTERPQQVCMGVMTVLSDIIRYFSPS
VPMPVCHTGKRVIPHDGAEDLWIQAQELVRNMKENLQLDFQFDWKLINVFFSNASQCYLC
PSAQQNGLAAGGVDELMGVLDYLQQEVPRAFVNLVDLSEVAEVSRQYHGTWLSPAPEPCN
CSEETTRLAKVVMQWSYQEAWNSLLASSRYSEQESFTVVFQPFFYETTPSLHSEDPRLQD
STTLAWHLWNRMMEPAGEKDEPLSVKHGRPMKCPSQESPYLFSYRNSNYLTRLQKPQDKL
EVREGAEIRCPDKDPSDTVPTSVHRLKPADINVIGALGDSLTAGNGAGSTPGNVLDVLTQ
YRGLSWSVGGDENIGTVTTLANILREFNPSLKGFSVGTGKETSPNAFLNQAVAGGRAEDL
PVQARRLVDLMKNDTRIHFQEDWKIITLFIGGNDLCDFCNDLVHYSPQNFTDNIGKALDI
LHAEVPRAFVNLVTVLEIVNLRELYQEKKVYCPRMILRSLCPCVLKFDDNSTELATLIEF
NKKFQEKTHQLIESGRYDTREDFTVVVQPFFENVDMPKTSEGLPDNSFFAPDCFHFSSKS
HSRAASALWNNMLEPVGQKTTRHKFENKINITCPNQVQPFLRTYKNSMQGHGTWLPCRDR
APSALHPTSVHALRPADIQVVAALGDSLTAGNGIGSKPDDLPDVTTQYRGLSYSAGGDGS
LENVTTLPNILREFNRNLTGYAVGTGDANDTNAFLNQAVPGAKAEDLMSQVQTLMQKMKD
DHRVNFHEDWKVITVLIGGSDLCDYCTDSNLYSAANFVHHLRNALDVLHREVPRVLVNLV
DFLNPTIMRQVFLGNPDKCPVQQASVLCNCVLTLRENSQELARLEAFSRAYRSSMRELVG
SGRYDTQEDFSVVLQPFFQNIQLPVLADGLPDTSFFAPDCIHPNQKFHSQLARALWTNML
EPLGSKTETLDLRAEMPITCPTQNEPFLRTPRNSNYTYPIKPAIENWGSDFLCTEWKASN
SVPTSVHQLRPADIKVVAALGDSLTTAVGARPNNSSDLPTSWRGLSWSIGGDGNLETHTT
LPNILKKFNPYLLGFSTSTWEGTAGLNVAAEGARARDMPAQAWDLVERMKNSPDINLEKD
WKLVTLFIGVNDLCHYCENPEAHLATEYVQHIQQALDILSEELPRAFVNVVEVMELASLY
QGQGGKCAMLAAQNNCTCLRHSQSSLEKQELKKVNWNLQHGISSFSYWHQYTQREDFAVV
VQPFFQNTLTPLNERGDTDLTFFSEDCFHFSDRGHAEMAIALWNNMLEPVGRKTTSNNFT
HSRAKLKCPSPESPYLYTLRNSRLLPDQAEEAPEVLYWAVPVAAGVGLVVGIIGTVVWRC
RRGGRREDPPMSLRTVAL

Sequence length

1458

Interactions

View interactions

	KEGG		Reactome
	Glycerophospholipid metabolism Ether lipid metabolism Arachidonic acid metabolism Linoleic acid metabolism alpha-Linolenic acid metabolism Metabolic pathways Vitamin digestion and absorption		Acyl chain remodelling of PC Retinoid metabolism and transport

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bowel incontinence	Fecal incontinence	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Diabetes	Visfatin levels in type 2 diabetes	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Intracranial Aneurysm	Intracranial aneurysm	N/A	N/A	GWAS

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Arthritis Rheumatoid	Associate	24520335
Breast Neoplasms	Associate	34803163
Glioblastoma	Associate	35185876
Insulinoma	Associate	29851790
Intervertebral Disc Degeneration	Associate	38007425
Lymphatic Metastasis	Associate	36779847
Neoplasm Metastasis	Associate	36779847
Neoplasms	Associate	35185876, 36779847
Peritonitis	Associate	36779847
Stomach Neoplasms	Associate	36779847

PLB1 (phospholipase B1)