Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1510
Gene name	Cathepsin E
Gene symbol	CTSE
Synonyms (NCBI Gene)	CATE
Chromosome	1
Chromosome location	1q32.1
Summary	This gene encodes a member of the A1 family of peptidases. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate the mature enzyme. T

Show/Hide all (76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050230	hsa-miR-25-3p	CLASH	23622248
MIRT550946	hsa-miR-595	PAR-CLIP	20371350
MIRT550945	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT550943	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT569479	hsa-miR-3650	PAR-CLIP	20371350
MIRT569478	hsa-miR-567	PAR-CLIP	20371350
MIRT550944	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT550941	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT550942	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT550940	hsa-miR-573	PAR-CLIP	20371350
MIRT569477	hsa-miR-297	PAR-CLIP	20371350
MIRT550939	hsa-miR-3611	PAR-CLIP	20371350
MIRT569476	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT550938	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT550946	hsa-miR-595	PAR-CLIP	21572407
MIRT550945	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT550943	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT550944	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT550941	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT550942	hsa-miR-3616-5p	PAR-CLIP	21572407
MIRT550940	hsa-miR-573	PAR-CLIP	21572407
MIRT550939	hsa-miR-3611	PAR-CLIP	21572407
MIRT550938	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT550946	hsa-miR-595	PAR-CLIP	20371350
MIRT550945	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT550943	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT569479	hsa-miR-3650	PAR-CLIP	20371350
MIRT569478	hsa-miR-567	PAR-CLIP	20371350
MIRT550944	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT550941	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT550942	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT550940	hsa-miR-573	PAR-CLIP	20371350
MIRT569477	hsa-miR-297	PAR-CLIP	20371350
MIRT550939	hsa-miR-3611	PAR-CLIP	20371350
MIRT569476	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT550938	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT550946	hsa-miR-595	PAR-CLIP	21572407
MIRT550945	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT550943	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT550944	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT550941	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT550942	hsa-miR-3616-5p	PAR-CLIP	21572407
MIRT550940	hsa-miR-573	PAR-CLIP	21572407
MIRT550939	hsa-miR-3611	PAR-CLIP	21572407
MIRT550938	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT915904	hsa-miR-129-5p	CLIP-seq
MIRT915905	hsa-miR-3064-3p	CLIP-seq
MIRT915906	hsa-miR-3143	CLIP-seq
MIRT915907	hsa-miR-3145-5p	CLIP-seq
MIRT915908	hsa-miR-3647-5p	CLIP-seq
MIRT915909	hsa-miR-3669	CLIP-seq
MIRT915910	hsa-miR-3977	CLIP-seq
MIRT915911	hsa-miR-4274	CLIP-seq
MIRT915912	hsa-miR-4476	CLIP-seq
MIRT915913	hsa-miR-4511	CLIP-seq
MIRT915914	hsa-miR-4530	CLIP-seq
MIRT915915	hsa-miR-4691-5p	CLIP-seq
MIRT915916	hsa-miR-4715-3p	CLIP-seq
MIRT915917	hsa-miR-4776-3p	CLIP-seq
MIRT915918	hsa-miR-543	CLIP-seq
MIRT915919	hsa-miR-640	CLIP-seq
MIRT915909	hsa-miR-3669	CLIP-seq
MIRT915910	hsa-miR-3977	CLIP-seq
MIRT1971624	hsa-miR-423-3p	CLIP-seq
MIRT2510454	hsa-miR-105	CLIP-seq
MIRT2510455	hsa-miR-3171	CLIP-seq
MIRT2510456	hsa-miR-3647-3p	CLIP-seq
MIRT2510457	hsa-miR-3662	CLIP-seq
MIRT2510458	hsa-miR-4282	CLIP-seq
MIRT2510459	hsa-miR-4698	CLIP-seq
MIRT2510454	hsa-miR-105	CLIP-seq
MIRT2510455	hsa-miR-3171	CLIP-seq
MIRT2510456	hsa-miR-3647-3p	CLIP-seq
MIRT2510457	hsa-miR-3662	CLIP-seq
MIRT2510458	hsa-miR-4282	CLIP-seq
MIRT2510459	hsa-miR-4698	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004190	Function	Aspartic-type endopeptidase activity	IBA
GO:0004190	Function	Aspartic-type endopeptidase activity	IDA	7789521
GO:0004190	Function	Aspartic-type endopeptidase activity	IEA
GO:0005768	Component	Endosome	IBA
GO:0005768	Component	Endosome	IDA	7983070
GO:0005768	Component	Endosome	IEA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	16997486
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IDA	16997486
GO:0008233	Function	Peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	8765029
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IEA
GO:0042802	Function	Identical protein binding	IEA

MIM	HGNC	e!Ensembl
116890	2530	ENSG00000196188

P14091

Protein name

Cathepsin E (EC 3.4.23.34) [Cleaved into: Cathepsin E form I; Cathepsin E form II]

Protein function

May have a role in immune function. Probably involved in the processing of antigenic peptides during MHC class II-mediated antigen presentation. May play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degenerati

PDB

1TZS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07966	A1_Propeptide	21 → 49	A1 Propeptide	Motif
PF00026	Asp	77 → 394	Eukaryotic aspartyl protease	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed abundantly in the stomach, the Clara cells of the lung and activated B-lymphocytes, and at lower levels in lymph nodes, skin and spleen. Not expressed in resting B-lymphocytes. {ECO:0000269|PubMed:11322887, ECO:0000269|PubMed

Sequence

MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESC
SMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRF
QPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAE
FDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSH
FSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNA
IGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDI
HPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP

Sequence length

396

Interactions

View interactions

	KEGG		Reactome
	Lysosome		MHC class II antigen presentation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	23451082	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Inhibit	25348778	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Papillary	Associate	23451082	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Stimulate	25348778	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Associate	34741638	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	23451082	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	29051346	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Signet Ring Cell	Associate	23451082	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	39471066	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	34741638	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death	Inhibit	25348778	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	34741638	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Stimulate	25348778	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	39471066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	17888866, 25348778, 39471066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	12000726, 32537471, 33815409, 38267509	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Stimulate	26488201	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Associate	26488201	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Dysplasia	Associate	25348778	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Associate	23451082	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	1370478, 23451082, 25348778, 2674141	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	33048468, 37325625, 40481075	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Associate	9094979	★★★★★ ★☆☆☆☆ Found in Text Mining only

CTSE (cathepsin E)