Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
150962
Gene name Gene Name - the full gene name approved by the HGNC.
Pseudouridine synthase 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PUS10
Synonyms (NCBI Gene) Gene synonyms aliases
CCDC139, DOBI, Hup10
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p16.1-p15
Summary Summary of gene provided in NCBI Entrez Gene.
Pseudouridination, the isomerization of uridine to pseudouridine, is the most common posttranscriptional nucleotide modification found in RNA and is essential for biologic functions such as spliceosome biogenesis. Pseudouridylate synthases, such as PUS10,
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018305 hsa-miR-335-5p Microarray 18185580
MIRT1277921 hsa-miR-1200 CLIP-seq
MIRT1277922 hsa-miR-1238 CLIP-seq
MIRT1277923 hsa-miR-1261 CLIP-seq
MIRT1277924 hsa-miR-1273f CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 32296183
GO:0005634 Component Nucleus IDA 30530625, 31819270
GO:0005737 Component Cytoplasm IDA 30530625, 31819270
GO:0005739 Component Mitochondrion IEA
GO:0009982 Function Pseudouridine synthase activity IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612787 26505 ENSG00000162927
Protein
UniProt ID Q3MIT2
Protein name tRNA pseudouridine synthase Pus10 (Hup10) (EC 5.4.99.25) (Coiled-coil domain-containing protein 139) (tRNA pseudouridine 55 synthase) (Psi55 synthase) (tRNA pseudouridylate synthase) (tRNA-uridine isomerase)
Protein function Protein with different functions depending on its subcellular location: involved in miRNA processing in the nucleus and acts as a tRNA pseudouridylate synthase in the cytoplasm (PubMed:31819270, PubMed:33023933). In the cytoplasm, acts as a pseu
PDB 2V9K
Family and domains
Sequence
MFPLTEENKHVAQLLLNTGTCPRCIFRFCGVDFHAPYKLPYKELLNELQKFLETEKDELI
LEVMNPPPKKIRLQELEDSIDNLSQNGEGRISVSHVGSTASKNSNLNVCNVCLGILQEFC
EKDFIKKVCQKVEASGFEFTSLVFSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRDDIV
QLKEAYKWITHPLFSEELGVPIDGKSLFEVSVVFAHPETVEDCHFLAAICPDCFKPAKNK
QSVFTRMAVMKALNKIKEEDFLKQFPCPPNSPKAVCAVLEIECAHGAVFVAGRYNKYSRN
LPQTPWIIDGERKLESSVEELISDHLLAVFKAESFNFSSSGREDVDVRTLGNGRPFAIEL
VNPHRVHFTSQEIKELQQKINNSSNKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWT
NKAIQKKDIEFLNDIKDLKIDQKTPLRVLHRRPLAVRARVIHFMETQYVDEHHFRLHLKT
QAGTYIKEFVHGDFGRTKPNIGSLMNVTADILELDVESVDVDWPPALDD
Sequence length 529
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Autoimmune diseases Autoimmune Diseases, AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1, AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2 rs869025224 21383967, 30595370
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Dermatitis Dermatitis, Atopic rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 26482879
Inflammatory bowel disease Inflammatory Bowel Diseases rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468 23128233, 28067908, 26192919
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma 21150878 ClinVar
Celiac disease Celiac Disease, Celiac disease 20190752, 23143596, 22057235, 21298027 ClinVar, GWAS
Crohn disease Crohn Disease 21298027, 22412388, 26192919, 26974007, 21102463, 18587394, 28067908 ClinVar
Ulcerative colitis Ulcerative colitis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Celiac Disease Associate 30968606
Genetic Diseases Inborn Associate 30122582
Intellectual Disability Associate 30122582
Neoplasms Associate 28981101
Neural Tube Defects Associate 30968606