CTRL (chymotrypsin like)

Gene

• Entrez ID: 1506
• Gene name: Chymotrypsin like
• Gene symbol: CTRL
• Synonyms (NCBI Gene): CTRL1
• Chromosome: 16
• Chromosome location: 16q22.1
• Summary: This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme. [provided by RefSeq, Sep 2016]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1971489	hsa-miR-1321	CLIP-seq
MIRT1971490	hsa-miR-2861	CLIP-seq
MIRT1971491	hsa-miR-3925-3p	CLIP-seq
MIRT1971492	hsa-miR-4270	CLIP-seq
MIRT1971493	hsa-miR-4441	CLIP-seq
MIRT1971494	hsa-miR-4512	CLIP-seq
MIRT1971495	hsa-miR-4685-5p	CLIP-seq
MIRT1971496	hsa-miR-4721	CLIP-seq
MIRT1971497	hsa-miR-4728-5p	CLIP-seq
MIRT1971498	hsa-miR-4739	CLIP-seq
MIRT1971499	hsa-miR-4756-5p	CLIP-seq
MIRT1971500	hsa-miR-766	CLIP-seq
MIRT2207270	hsa-miR-1227	CLIP-seq
MIRT2207271	hsa-miR-1237	CLIP-seq
MIRT2207272	hsa-miR-3182	CLIP-seq
MIRT2207273	hsa-miR-4690-3p	CLIP-seq
MIRT2207274	hsa-miR-512-5p	CLIP-seq
MIRT2207275	hsa-miR-668	CLIP-seq
MIRT2207276	hsa-miR-888	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	IDA	9065485
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IDA	9065485
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030163	Process	Protein catabolic process	IC	9065485

Other IDs

• MIM: 118888
• HGNC: 2524
• e!Ensembl: ENSG00000141086

Protein

• UniProt ID: P40313
• Protein name: Chymotrypsin-like protease CTRL-1 (EC 3.4.21.-)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	34 → 257	Trypsin	Domain

• Sequence:

  MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFC
  GGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNN
  DVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALP
  LVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCN
  VRAPAVYTRVSKFSTWINQVIAYN

• Sequence length: 264

Pathways

KEGG:

Pancreatic secretion
Protein digestion and absorption

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Long QT syndrome	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Hematologic Neoplasms	Associate	19671918, 25578495	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Associate	34524912	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Stimulate	18224667	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	19671918	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	25578495	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	12616123	★☆☆☆☆ Found in Text Mining only