YDJC (YdjC chitooligosaccharide deacetylase homolog)

Gene

• Entrez ID: 150223
• Gene name: YdjC chitooligosaccharide deacetylase homolog
• Gene symbol: YDJC
• Synonyms (NCBI Gene): -
• Chromosome: 22
• Chromosome location: 22q11.21

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT041237	hsa-miR-193b-3p	CLASH	23622248
MIRT040030	hsa-miR-615-3p	CLASH	23622248
MIRT038947	hsa-miR-28-3p	CLASH	23622248
MIRT036985	hsa-miR-877-3p	CLASH	23622248
MIRT563187	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT563185	hsa-miR-3651	PAR-CLIP	20371350
MIRT563186	hsa-miR-889-3p	PAR-CLIP	20371350
MIRT407462	hsa-miR-4477a	PAR-CLIP	20371350
MIRT563184	hsa-miR-488-3p	PAR-CLIP	20371350
MIRT563187	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT563185	hsa-miR-3651	PAR-CLIP	20371350
MIRT563186	hsa-miR-889-3p	PAR-CLIP	20371350
MIRT407462	hsa-miR-4477a	PAR-CLIP	20371350
MIRT563184	hsa-miR-488-3p	PAR-CLIP	20371350
MIRT1498390	hsa-miR-1184	CLIP-seq
MIRT1498391	hsa-miR-1245b-5p	CLIP-seq
MIRT1498392	hsa-miR-1263	CLIP-seq
MIRT1498393	hsa-miR-3064-3p	CLIP-seq
MIRT1498394	hsa-miR-3142	CLIP-seq
MIRT1498395	hsa-miR-323b-5p	CLIP-seq
MIRT1498396	hsa-miR-3936	CLIP-seq
MIRT1498397	hsa-miR-421	CLIP-seq
MIRT1498398	hsa-miR-4438	CLIP-seq
MIRT1498399	hsa-miR-4450	CLIP-seq
MIRT1498400	hsa-miR-4473	CLIP-seq
MIRT1498401	hsa-miR-4671-3p	CLIP-seq
MIRT1498402	hsa-miR-4709-5p	CLIP-seq
MIRT1498403	hsa-miR-4763-5p	CLIP-seq
MIRT1498404	hsa-miR-505	CLIP-seq
MIRT1498405	hsa-miR-512-3p	CLIP-seq
MIRT1498406	hsa-miR-520f	CLIP-seq
MIRT1498407	hsa-miR-578	CLIP-seq
MIRT1498408	hsa-miR-636	CLIP-seq
MIRT2150102	hsa-miR-105	CLIP-seq
MIRT2150103	hsa-miR-1913	CLIP-seq
MIRT2150104	hsa-miR-3184	CLIP-seq
MIRT2150105	hsa-miR-3189-5p	CLIP-seq
MIRT2150106	hsa-miR-324-3p	CLIP-seq
MIRT2150107	hsa-miR-33a	CLIP-seq
MIRT2150108	hsa-miR-33b	CLIP-seq
MIRT2150109	hsa-miR-423-5p	CLIP-seq
MIRT2150110	hsa-miR-4688	CLIP-seq
MIRT2150111	hsa-miR-4758-3p	CLIP-seq
MIRT2150112	hsa-miR-4802-3p	CLIP-seq
MIRT2150113	hsa-miR-4802-5p	CLIP-seq
MIRT2150114	hsa-miR-493	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	ISS
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0019213	Function	Deacetylase activity	IBA	21873635

Other IDs

• MIM: 619770
• HGNC: 27158
• e!Ensembl: ENSG00000161179

Protein

• UniProt ID: A8MPS7
• Protein name: Carbohydrate deacetylase (EC 3.5.1.-)
• Protein function: Probably catalyzes the deacetylation of acetylated carbohydrates an important step in the degradation of oligosaccharides.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04794	YdjC	7 → 288	YdjC-like protein	Family

• Sequence:

  MSRPRMRLVVTADDFGYCPRRDEGIVEAFLAGAVTSVSLLVNGAATESAAELARRHSIPT
  GLHANLSEGRPVGPARRGASSLLGPEGFFLGKMGFREAVAAGDVDLPQVREELEAQLSCF
  RELLGRAPTHADGHQHVHVLPGVCQVFAEALQAYGVRFTRLPLERGVGGCTWLEAPARAF
  ACAVERDARAAVGPFSRHGLRWTDAFVGLSTCGRHMSAHRVSGALARVLEGTLAGHTLTA
  ELMAHPGYPSVPPTGGCGEGPDAFSCSWERLHELRVLTAPTLRAQLAQDGVQLCALDDLD
  SKRPGEEVPCEPTLEPFLEPSLL

• Sequence length: 323

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Autoimmune diseases	Autoimmune Diseases	rs869025224	21383967

Unknown
Disease term	Disease name	Evidence	References	Source
Celiac disease	Celiac Disease, Celiac disease		20190752	ClinVar, GWAS
Rheumatoid arthritis	Rheumatoid arthritis			GWAS
Eczema	Eczema			GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus			GWAS
Psoriasis	Psoriasis			GWAS
Crohn Disease	Crohn Disease			GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease			GWAS
Ulcerative colitis	Ulcerative colitis			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Arthritis Psoriatic	Associate	35507331
Autoimmune Diseases	Associate	34279042
Graves Disease	Associate	27094594
Hashimoto Disease	Associate	27094594
Inflammatory Bowel Diseases	Associate	23474282