Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	150084
Gene name Gene Name - the full gene name approved by the HGNC.	Immunoglobulin superfamily member 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IGSF5
Synonyms (NCBI Gene) Gene synonyms aliases	GSF5, JAM4
Chromosome Chromosome number	21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	21q22.2

Show/Hide all(43)

miRTarBase ID	miRNA	Experiments
MIRT1062766	hsa-miR-1297	CLIP-seq
MIRT1062767	hsa-miR-2052	CLIP-seq
MIRT1062768	hsa-miR-2110	CLIP-seq
MIRT1062769	hsa-miR-219-2-3p	CLIP-seq
MIRT1062770	hsa-miR-26a	CLIP-seq
MIRT1062771	hsa-miR-26b	CLIP-seq
MIRT1062772	hsa-miR-2964a-3p	CLIP-seq
MIRT1062773	hsa-miR-302a	CLIP-seq
MIRT1062774	hsa-miR-302b	CLIP-seq
MIRT1062775	hsa-miR-302c	CLIP-seq
MIRT1062776	hsa-miR-302d	CLIP-seq
MIRT1062777	hsa-miR-302e	CLIP-seq
MIRT1062778	hsa-miR-3150a-3p	CLIP-seq
MIRT1062779	hsa-miR-3157-5p	CLIP-seq
MIRT1062780	hsa-miR-3676	CLIP-seq
MIRT1062781	hsa-miR-372	CLIP-seq
MIRT1062782	hsa-miR-373	CLIP-seq
MIRT1062783	hsa-miR-4271	CLIP-seq
MIRT1062784	hsa-miR-4277	CLIP-seq
MIRT1062785	hsa-miR-4452	CLIP-seq
MIRT1062786	hsa-miR-4453	CLIP-seq
MIRT1062787	hsa-miR-4465	CLIP-seq
MIRT1062788	hsa-miR-4480	CLIP-seq
MIRT1062789	hsa-miR-4502	CLIP-seq
MIRT1062790	hsa-miR-4538	CLIP-seq
MIRT1062791	hsa-miR-4633-3p	CLIP-seq
MIRT1062792	hsa-miR-4643	CLIP-seq
MIRT1062793	hsa-miR-466	CLIP-seq
MIRT1062794	hsa-miR-4691-3p	CLIP-seq
MIRT1062795	hsa-miR-4694-5p	CLIP-seq
MIRT1062796	hsa-miR-4725-3p	CLIP-seq
MIRT1062797	hsa-miR-4747-5p	CLIP-seq
MIRT1062798	hsa-miR-4762-3p	CLIP-seq
MIRT1062799	hsa-miR-4789-3p	CLIP-seq
MIRT1062800	hsa-miR-520a-3p	CLIP-seq
MIRT1062801	hsa-miR-520b	CLIP-seq
MIRT1062802	hsa-miR-520c-3p	CLIP-seq
MIRT1062803	hsa-miR-520d-3p	CLIP-seq
MIRT1062804	hsa-miR-520e	CLIP-seq
MIRT1062805	hsa-miR-548an	CLIP-seq
MIRT2014810	hsa-miR-365	CLIP-seq
MIRT2014811	hsa-miR-4641	CLIP-seq
MIRT2247116	hsa-miR-490-5p	CLIP-seq

Show/Hide all(5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005923	Component	Bicellular tight junction	IBA	21873635
GO:0009986	Component	Cell surface	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0098609	Process	Cell-cell adhesion	IBA	21873635

MIM	HGNC	e!Ensembl
610638	5952	ENSG00000183067

Protein

UniProt ID

Q9NSI5

Protein name

Immunoglobulin superfamily member 5 (IgSF5) (Junctional adhesion molecule 4) (JAM-4)

Protein function

Provides, together with MAGI1, an adhesion machinery at tight junctions, which may regulate the permeability of kidney glomerulus and small intestinal epithelial cells. Mediates calcium-independent homophilic cell adhesion. In testis, it may fun

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07679	I-set	39 → 140	Immunoglobulin I-set domain	Domain

Sequence

MGQKERSTADTLPDLEEWKSAAGLRWWQTAVVDGSGSGNEVIEGPQNARVLKGSQARFNC
TVSQGWKLIMWALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVEPSDSGN
IRCSLQNSRLHGSAYLTVQVMGELFIPSVNLVVAENEPCEVTCLPSHWTRLPDISWELGL
LVSHSSYYFVPEPSDLQSAVSILALTPQSNGTLTCVATWKSLKARKSATVNLTVIRCPQD
TGGGINIPGVLSSLPSLGFSLPTWGKVGLGLAGTMLLTPTCTLTIRCCCCRRRCCGCNCC
CRCCFCCRRKRGFRIQFQKKSEKEKTNKETETESGNENSGYNSDEQKTTDTASLPPKSCE
SSDPEQRNSSCGPPHQRADQRPPRPASHPQASFNLASPEKVSNTTVV

Sequence length

407

Interactions

View interactions

	KEGG
	Tight junction Epithelial cell signaling in Helicobacter pylori infection

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Evidence	Source
Unknown
Hypertension	Hypertension		GWAS
Asthma	Asthma		GWAS
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Asthma	Associate	35524249
Inflammation	Associate	28206970
Non alcoholic Fatty Liver Disease	Associate	28206970
Obesity	Associate	35524249
Squamous Cell Carcinoma of Head and Neck	Associate	33506058

IGSF5 (immunoglobulin superfamily member 5)