Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	150
Gene name Gene Name - the full gene name approved by the HGNC.	Adrenoceptor alpha 2A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADRA2A
Synonyms (NCBI Gene) Gene synonyms aliases	ADRA2, ADRA2R, ADRAR, ALPHA2AAR, FPLD8, ZNF32
Disease Acronyms (UniProt) Disease acronyms from UniProt database	FPLD8
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q25.2
Summary Summary of gene provided in NCBI Entrez Gene.	Alpha-2-adrenergic receptors are members of the G protein-coupled receptor superfamily. The alpha-2-adrenergic receptors are a type of adrenergic receptors (for adrenaline or epinephrine), which inhibit adenylate cyclase. These receptors include 3 highly

Show/Hide all(222)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029792	hsa-miR-26b-5p	Microarray	19088304
MIRT769817	hsa-miR-106a	CLIP-seq
MIRT769818	hsa-miR-106b	CLIP-seq
MIRT769819	hsa-miR-1179	CLIP-seq
MIRT769820	hsa-miR-1207-5p	CLIP-seq
MIRT769821	hsa-miR-1226	CLIP-seq
MIRT769822	hsa-miR-1271	CLIP-seq
MIRT769823	hsa-miR-1291	CLIP-seq
MIRT769824	hsa-miR-1294	CLIP-seq
MIRT769825	hsa-miR-135a	CLIP-seq
MIRT769826	hsa-miR-135b	CLIP-seq
MIRT769827	hsa-miR-138	CLIP-seq
MIRT769828	hsa-miR-141	CLIP-seq
MIRT769829	hsa-miR-148a	CLIP-seq
MIRT769830	hsa-miR-148b	CLIP-seq
MIRT769831	hsa-miR-152	CLIP-seq
MIRT769832	hsa-miR-17	CLIP-seq
MIRT769833	hsa-miR-182	CLIP-seq
MIRT769834	hsa-miR-1825	CLIP-seq
MIRT769835	hsa-miR-1827	CLIP-seq
MIRT769836	hsa-miR-185	CLIP-seq
MIRT769837	hsa-miR-199a-5p	CLIP-seq
MIRT769838	hsa-miR-199b-5p	CLIP-seq
MIRT769839	hsa-miR-200a	CLIP-seq
MIRT769840	hsa-miR-20a	CLIP-seq
MIRT769841	hsa-miR-20b	CLIP-seq
MIRT769842	hsa-miR-216a	CLIP-seq
MIRT769843	hsa-miR-2355-5p	CLIP-seq
MIRT769844	hsa-miR-296-5p	CLIP-seq
MIRT769845	hsa-miR-3065-3p	CLIP-seq
MIRT769846	hsa-miR-3119	CLIP-seq
MIRT769847	hsa-miR-3123	CLIP-seq
MIRT769848	hsa-miR-3126-5p	CLIP-seq
MIRT769849	hsa-miR-3150a-3p	CLIP-seq
MIRT769850	hsa-miR-3158-3p	CLIP-seq
MIRT769851	hsa-miR-3174	CLIP-seq
MIRT769852	hsa-miR-3175	CLIP-seq
MIRT769853	hsa-miR-3184	CLIP-seq
MIRT769854	hsa-miR-3189-5p	CLIP-seq
MIRT769855	hsa-miR-3194-3p	CLIP-seq
MIRT769856	hsa-miR-328	CLIP-seq
MIRT769857	hsa-miR-330-3p	CLIP-seq
MIRT769858	hsa-miR-339-5p	CLIP-seq
MIRT769859	hsa-miR-33a	CLIP-seq
MIRT769860	hsa-miR-33b	CLIP-seq
MIRT769861	hsa-miR-3591-3p	CLIP-seq
MIRT769862	hsa-miR-3609	CLIP-seq
MIRT769863	hsa-miR-3613-3p	CLIP-seq
MIRT769864	hsa-miR-3616-3p	CLIP-seq
MIRT769865	hsa-miR-3675-5p	CLIP-seq
MIRT769866	hsa-miR-3677-5p	CLIP-seq
MIRT769867	hsa-miR-3679-3p	CLIP-seq
MIRT769868	hsa-miR-371-5p	CLIP-seq
MIRT769869	hsa-miR-371b-5p	CLIP-seq
MIRT769870	hsa-miR-376c	CLIP-seq
MIRT769871	hsa-miR-3919	CLIP-seq
MIRT769872	hsa-miR-3978	CLIP-seq
MIRT769873	hsa-miR-423-5p	CLIP-seq
MIRT769874	hsa-miR-4254	CLIP-seq
MIRT769875	hsa-miR-4280	CLIP-seq
MIRT769876	hsa-miR-4299	CLIP-seq
MIRT769877	hsa-miR-4306	CLIP-seq
MIRT769878	hsa-miR-4308	CLIP-seq
MIRT769879	hsa-miR-4311	CLIP-seq
MIRT769880	hsa-miR-4316	CLIP-seq
MIRT769881	hsa-miR-4327	CLIP-seq
MIRT769882	hsa-miR-4419a	CLIP-seq
MIRT769883	hsa-miR-4424	CLIP-seq
MIRT769884	hsa-miR-4436b-3p	CLIP-seq
MIRT769885	hsa-miR-4446-3p	CLIP-seq
MIRT769886	hsa-miR-4446-5p	CLIP-seq
MIRT769887	hsa-miR-4459	CLIP-seq
MIRT769888	hsa-miR-4470	CLIP-seq
MIRT769889	hsa-miR-4475	CLIP-seq
MIRT769890	hsa-miR-4488	CLIP-seq
MIRT769891	hsa-miR-4508	CLIP-seq
MIRT769892	hsa-miR-4510	CLIP-seq
MIRT769893	hsa-miR-4514	CLIP-seq
MIRT769894	hsa-miR-4519	CLIP-seq
MIRT769895	hsa-miR-4520a-3p	CLIP-seq
MIRT769896	hsa-miR-4525	CLIP-seq
MIRT769897	hsa-miR-4644	CLIP-seq
MIRT769898	hsa-miR-4656	CLIP-seq
MIRT769899	hsa-miR-4659a-3p	CLIP-seq
MIRT769900	hsa-miR-4659b-3p	CLIP-seq
MIRT769901	hsa-miR-4672	CLIP-seq
MIRT769902	hsa-miR-4675	CLIP-seq
MIRT769903	hsa-miR-4677-3p	CLIP-seq
MIRT769904	hsa-miR-4688	CLIP-seq
MIRT769905	hsa-miR-4692	CLIP-seq
MIRT769906	hsa-miR-4697-5p	CLIP-seq
MIRT769907	hsa-miR-4699-3p	CLIP-seq
MIRT769908	hsa-miR-4704-3p	CLIP-seq
MIRT769909	hsa-miR-4709-3p	CLIP-seq
MIRT769910	hsa-miR-4711-5p	CLIP-seq
MIRT769911	hsa-miR-4718	CLIP-seq
MIRT769912	hsa-miR-4721	CLIP-seq
MIRT769913	hsa-miR-4722-5p	CLIP-seq
MIRT769914	hsa-miR-4728-5p	CLIP-seq
MIRT769915	hsa-miR-4729	CLIP-seq
MIRT769916	hsa-miR-4733-3p	CLIP-seq
MIRT769917	hsa-miR-4736	CLIP-seq
MIRT769918	hsa-miR-4741	CLIP-seq
MIRT769919	hsa-miR-4755-5p	CLIP-seq
MIRT769920	hsa-miR-4756-3p	CLIP-seq
MIRT769921	hsa-miR-4763-3p	CLIP-seq
MIRT769922	hsa-miR-4778-3p	CLIP-seq
MIRT769923	hsa-miR-4779	CLIP-seq
MIRT769924	hsa-miR-4781-5p	CLIP-seq
MIRT769925	hsa-miR-4789-5p	CLIP-seq
MIRT769926	hsa-miR-4796-3p	CLIP-seq
MIRT769927	hsa-miR-486-3p	CLIP-seq
MIRT769928	hsa-miR-498	CLIP-seq
MIRT769929	hsa-miR-518a-5p	CLIP-seq
MIRT769930	hsa-miR-519d	CLIP-seq
MIRT769931	hsa-miR-520f	CLIP-seq
MIRT769932	hsa-miR-527	CLIP-seq
MIRT769933	hsa-miR-548ad	CLIP-seq
MIRT769934	hsa-miR-548ah	CLIP-seq
MIRT769935	hsa-miR-570	CLIP-seq
MIRT769936	hsa-miR-582-5p	CLIP-seq
MIRT769937	hsa-miR-636	CLIP-seq
MIRT769938	hsa-miR-663b	CLIP-seq
MIRT769939	hsa-miR-670	CLIP-seq
MIRT769940	hsa-miR-873	CLIP-seq
MIRT769941	hsa-miR-875-3p	CLIP-seq
MIRT769942	hsa-miR-93	CLIP-seq
MIRT769943	hsa-miR-938	CLIP-seq
MIRT769944	hsa-miR-939	CLIP-seq
MIRT769945	hsa-miR-940	CLIP-seq
MIRT769946	hsa-miR-96	CLIP-seq
MIRT1927076	hsa-miR-3692	CLIP-seq
MIRT1927077	hsa-miR-3977	CLIP-seq
MIRT1927078	hsa-miR-4464	CLIP-seq
MIRT1927079	hsa-miR-4748	CLIP-seq
MIRT769922	hsa-miR-4778-3p	CLIP-seq
MIRT769820	hsa-miR-1207-5p	CLIP-seq
MIRT769822	hsa-miR-1271	CLIP-seq
MIRT2167980	hsa-miR-1289	CLIP-seq
MIRT2167981	hsa-miR-1324	CLIP-seq
MIRT769833	hsa-miR-182	CLIP-seq
MIRT769843	hsa-miR-2355-5p	CLIP-seq
MIRT769845	hsa-miR-3065-3p	CLIP-seq
MIRT769848	hsa-miR-3126-5p	CLIP-seq
MIRT769849	hsa-miR-3150a-3p	CLIP-seq
MIRT769850	hsa-miR-3158-3p	CLIP-seq
MIRT769853	hsa-miR-3184	CLIP-seq
MIRT2167982	hsa-miR-3189-3p	CLIP-seq
MIRT2167983	hsa-miR-3198	CLIP-seq
MIRT2167984	hsa-miR-346	CLIP-seq
MIRT2167985	hsa-miR-34a	CLIP-seq
MIRT2167986	hsa-miR-34c-5p	CLIP-seq
MIRT769861	hsa-miR-3591-3p	CLIP-seq
MIRT769866	hsa-miR-3677-5p	CLIP-seq
MIRT769867	hsa-miR-3679-3p	CLIP-seq
MIRT1927076	hsa-miR-3692	CLIP-seq
MIRT769870	hsa-miR-376c	CLIP-seq
MIRT1927077	hsa-miR-3977	CLIP-seq
MIRT769873	hsa-miR-423-5p	CLIP-seq
MIRT2167987	hsa-miR-4288	CLIP-seq
MIRT2167988	hsa-miR-4294	CLIP-seq
MIRT2167989	hsa-miR-4309	CLIP-seq
MIRT2167990	hsa-miR-431	CLIP-seq
MIRT2167991	hsa-miR-432	CLIP-seq
MIRT2167992	hsa-miR-4436b-5p	CLIP-seq
MIRT769887	hsa-miR-4459	CLIP-seq
MIRT1927078	hsa-miR-4464	CLIP-seq
MIRT2167993	hsa-miR-449a	CLIP-seq
MIRT2167994	hsa-miR-449b	CLIP-seq
MIRT769891	hsa-miR-4508	CLIP-seq
MIRT769904	hsa-miR-4688	CLIP-seq
MIRT769907	hsa-miR-4699-3p	CLIP-seq
MIRT2167995	hsa-miR-4711-3p	CLIP-seq
MIRT769913	hsa-miR-4722-5p	CLIP-seq
MIRT1927079	hsa-miR-4748	CLIP-seq
MIRT769921	hsa-miR-4763-3p	CLIP-seq
MIRT769922	hsa-miR-4778-3p	CLIP-seq
MIRT769923	hsa-miR-4779	CLIP-seq
MIRT2167996	hsa-miR-483-3p	CLIP-seq
MIRT769927	hsa-miR-486-3p	CLIP-seq
MIRT2167997	hsa-miR-548ac	CLIP-seq
MIRT2167998	hsa-miR-548ae	CLIP-seq
MIRT2167999	hsa-miR-548aj	CLIP-seq
MIRT2168000	hsa-miR-548am	CLIP-seq
MIRT2168001	hsa-miR-548d-3p	CLIP-seq
MIRT2168002	hsa-miR-548x	CLIP-seq
MIRT2168003	hsa-miR-548z	CLIP-seq
MIRT2168004	hsa-miR-632	CLIP-seq
MIRT2168005	hsa-miR-640	CLIP-seq
MIRT2168006	hsa-miR-646	CLIP-seq
MIRT2168007	hsa-miR-654-3p	CLIP-seq
MIRT769946	hsa-miR-96	CLIP-seq
MIRT769828	hsa-miR-141	CLIP-seq
MIRT769836	hsa-miR-185	CLIP-seq
MIRT769839	hsa-miR-200a	CLIP-seq
MIRT769872	hsa-miR-3978	CLIP-seq
MIRT769877	hsa-miR-4306	CLIP-seq
MIRT769881	hsa-miR-4327	CLIP-seq
MIRT769897	hsa-miR-4644	CLIP-seq
MIRT769941	hsa-miR-875-3p	CLIP-seq
MIRT769820	hsa-miR-1207-5p	CLIP-seq
MIRT769822	hsa-miR-1271	CLIP-seq
MIRT2470519	hsa-miR-1305	CLIP-seq
MIRT769833	hsa-miR-182	CLIP-seq
MIRT769917	hsa-miR-4736	CLIP-seq
MIRT769921	hsa-miR-4763-3p	CLIP-seq
MIRT2470520	hsa-miR-511	CLIP-seq
MIRT769946	hsa-miR-96	CLIP-seq
MIRT769820	hsa-miR-1207-5p	CLIP-seq
MIRT2674631	hsa-miR-1258	CLIP-seq
MIRT769822	hsa-miR-1271	CLIP-seq
MIRT2470519	hsa-miR-1305	CLIP-seq
MIRT769833	hsa-miR-182	CLIP-seq
MIRT2674632	hsa-miR-3148	CLIP-seq
MIRT2674633	hsa-miR-3622a-5p	CLIP-seq
MIRT2674634	hsa-miR-4423-3p	CLIP-seq
MIRT769895	hsa-miR-4520a-3p	CLIP-seq
MIRT2674635	hsa-miR-4694-3p	CLIP-seq
MIRT769917	hsa-miR-4736	CLIP-seq
MIRT769921	hsa-miR-4763-3p	CLIP-seq
MIRT2470520	hsa-miR-511	CLIP-seq
MIRT769946	hsa-miR-96	CLIP-seq

Show/Hide all(67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IDA	17655843
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004938	Function	Alpha2-adrenergic receptor activity	IBA	21873635
GO:0004938	Function	Alpha2-adrenergic receptor activity	IDA	10948191
GO:0004938	Function	Alpha2-adrenergic receptor activity	ISS	1354394
GO:0005515	Function	Protein binding	IPI	16531006, 16605244
GO:0005737	Component	Cytoplasm	IDA	19477270
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	2823383, 10948191, 10948198
GO:0006940	Process	Regulation of smooth muscle contraction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	17215105, 17655843
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS	19965390
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS	12529373
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS	1354394
GO:0007265	Process	Ras protein signal transduction	TAS	8226727
GO:0007266	Process	Rho protein signal transduction	TAS	9624180
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10896916
GO:0010700	Process	Negative regulation of norepinephrine secretion	NAS	16531006
GO:0010700	Process	Negative regulation of norepinephrine secretion	TAS	19477270
GO:0016323	Component	Basolateral plasma membrane	TAS	17655843
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0019901	Function	Protein kinase binding	IPI	15653687
GO:0030036	Process	Actin cytoskeleton organization	TAS	9624180
GO:0030168	Process	Platelet activation	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	17655843
GO:0031692	Function	Alpha-1B adrenergic receptor binding	ISS
GO:0031696	Function	Alpha-2C adrenergic receptor binding	IPI	16605244
GO:0031996	Function	Thioesterase binding	IPI	19477270
GO:0032147	Process	Activation of protein kinase activity	IDA	15653687
GO:0032148	Process	Activation of protein kinase B activity	IDA	17215105
GO:0032795	Function	Heterotrimeric G-protein binding	IDA	10948191
GO:0032811	Process	Negative regulation of epinephrine secretion	NAS	16531006
GO:0032870	Process	Cellular response to hormone stimulus	IGI	10948198
GO:0035624	Process	Receptor transactivation	IDA	17215105, 17655843
GO:0042593	Process	Glucose homeostasis	IMP	10952463
GO:0042596	Process	Fear response	IEA
GO:0042802	Function	Identical protein binding	IPI	16605244
GO:0042803	Function	Protein homodimerization activity	IDA	16605244
GO:0043235	Component	Receptor complex	IDA	10948191
GO:0043268	Process	Positive regulation of potassium ion transport	ISS	1354394
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	19477270
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	10948191
GO:0045741	Process	Positive regulation of epidermal growth factor-activated receptor activity	IDA	17655843
GO:0045955	Process	Negative regulation of calcium ion-dependent exocytosis	IC	10952463
GO:0046676	Process	Negative regulation of insulin secretion	IMP	10952463
GO:0046982	Function	Protein heterodimerization activity	IPI	16605244
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0050796	Process	Regulation of insulin secretion	TAS
GO:0050892	Process	Intestinal absorption	TAS	17655843
GO:0050995	Process	Negative regulation of lipid catabolic process	IGI	10948198
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IDA	17655843
GO:0051379	Function	Epinephrine binding	IBA	21873635
GO:0051379	Function	Epinephrine binding	IDA	2823383, 10948191
GO:0051380	Function	Norepinephrine binding	IDA	2823383
GO:0051926	Process	Negative regulation of calcium ion transport	ISS
GO:0061179	Process	Negative regulation of insulin secretion involved in cellular response to glucose stimulus	IMP	19965390
GO:0071875	Process	Adrenergic receptor signaling pathway	IDA	10948191
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	21873635
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	ISS
GO:0071881	Process	Adenylate cyclase-inhibiting adrenergic receptor signaling pathway	IDA	10948191
GO:0071882	Process	Phospholipase C-activating adrenergic receptor signaling pathway	IDA	10948191
GO:0090303	Process	Positive regulation of wound healing	IMP	17655843
GO:0098691	Component	Dopaminergic synapse	IEA
GO:1901020	Process	Negative regulation of calcium ion transmembrane transporter activity	ISS	1354394
GO:2000300	Process	Regulation of synaptic vesicle exocytosis	IEA

MIM	HGNC	e!Ensembl
104210	281	ENSG00000150594

Protein

UniProt ID

P08913

Protein name

Alpha-2A adrenergic receptor (Alpha-2 adrenergic receptor subtype C10) (Alpha-2A adrenoreceptor) (Alpha-2A adrenoceptor) (Alpha-2AAR)

Protein function

Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The rank order of potency for agonists of this receptor is oxymetazoline > clonidine > epinephrine > norepinephrine

PDB

1HLL , 1HO9 , 1HOD , 1HOF , 6K42 , 6KUX , 6KUY , 7EJ0 , 7EJ8 , 7EJA , 7EJK , 7W6P , 7W7E , 9CBL , 9CBM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	50 → 426	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLML
LTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAW
CEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVIS
FPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKR
RTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGP
RDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTP
AAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPR
TLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV

Sequence length

465

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway Neuroactive ligand-receptor interaction Hormone signaling		Adrenoceptors Adrenaline signalling through Alpha-2 adrenergic receptor Adrenaline,noradrenaline inhibits insulin secretion G alpha (i) signalling events G alpha (z) signalling events Surfactant metabolism

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Epilepsy	Epilepsy, Epilepsy, Cryptogenic, Awakening Epilepsy	rs113994140, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs387906420, rs121917752, rs121918622, rs281865564, rs387907313, rs397514670 View all (165 more)	17341653
Hypertension	Hypertensive disease	rs13306026	10694191
Partial lipodystrophy	Familial partial lipodystrophy	rs121909244, rs72551362, rs72551363, rs72551364, rs121909245, rs121909246, rs28928900, rs57520892, rs60864230, rs57920071, rs61282106, rs61214927, rs1567075176, rs1567075667, rs587776968 View all (12 more)	27376152
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	25163438, 19439247, 22940547, 17034020

Show/Hide Unknown Diseases (6)

Disease term	Disease name	References	Source
Unknown
Cirrhosis	Cirrhosis	20083574	ClinVar
Mental depression	Mental Depression, Depressive disorder	18794646, 21859713, 16333651, 11425914	ClinVar
Lipodystrophy	lipodystrophy, familial partial, type 8, lipodystrophy		GenCC
Insomnia	Insomnia		GWAS
Metabolic Syndrome	Metabolic Syndrome		GWAS
Diabetes	Diabetes		GWAS

Show/Hide Text Mining Associations (48)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	36759514
Anxiety	Associate	33915198
Asthma	Associate	23148572
Attention Deficit and Disruptive Behavior Disorders	Associate	25964505
Attention Deficit Disorder with Hyperactivity	Associate	20146095, 20731965, 24978879, 25964505, 27091191, 32791971, 34573389
Behcet Syndrome	Associate	39278467
Bipolar and Related Disorders	Associate	39278467
Bipolar Disorder	Associate	39278467
Blood Platelet Disorders	Associate	20526338, 29865896
Body Weight	Associate	34573389
Bone Diseases	Associate	25818344
Breast Neoplasms	Associate	26563278, 31218733
Carcinoma Hepatocellular	Associate	30009772
Cerebral Palsy	Associate	20731965
Cholelithiasis	Associate	24556804
Cognition Disorders	Stimulate	28117912
Colonic Neoplasms	Associate	1677644
Depressive Disorder	Associate	28117912
Diabetes Gestational	Associate	28976299, 36313769
Diabetes Mellitus	Associate	22061269
Diabetes Mellitus Type 2	Associate	21325151, 22061269, 23153004, 25946000, 27655316, 37140276
Diffuse Neurofibrillary Tangles with Calcification	Associate	28117912
Drug Hypersensitivity	Associate	37828025
Fatty Liver Alcoholic	Associate	30009772
Fractures Bone	Associate	30033441
Gallbladder Neoplasms	Associate	24556804
Hyperglycemia	Associate	27131769
Hyperkinesis	Associate	34720019
Hypertension	Associate	19562039
Hypoglycemia	Associate	22061269
Hypotension	Associate	21325151
Mental Disorders	Associate	23808549
Metabolic Diseases	Associate	26563278
Motion Sickness	Associate	34948773
Myocardial Infarction	Associate	27131769
Neoplasms	Associate	26563278, 31218733, 36253428
Obesity	Associate	11886485, 17512307, 39336728
Osteoporosis	Associate	25818344, 30033441
Osteoporotic Fractures	Associate	30033441
Osteoporotic Fractures	Stimulate	30033441
Polycystic Ovary Syndrome	Associate	34720019, 37140276
Raynaud Disease	Associate	37828025
Sleep Initiation and Maintenance Disorders	Associate	31505070
Tooth Resorption	Associate	25818344
Vasospasm Intracranial	Associate	37828025
Venous Thromboembolism	Associate	29865896
Venous Thrombosis	Associate	29865896
Vomiting	Associate	34948773

ADRA2A (adrenoceptor alpha 2A)