Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	15
Gene name Gene Name - the full gene name approved by the HGNC.	Aralkylamine N-acetyltransferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AANAT
Synonyms (NCBI Gene) Gene synonyms aliases	DSPS, SNAT
Disease Acronyms (UniProt) Disease acronyms from UniProt database	DSPS
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the acetyltransferase superfamily. It is the penultimate enzyme in melatonin synthesis and controls the night/day rhythm in melatonin production in the vertebrate pineal gland. Melatonin is essential for the fun

Show/Hide all(2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054775	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR	24423866
MIRT736601	hsa-miR-483-3p	Luciferase reporter assay, Northern blotting, qRT-PCR	22908386

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004059	Function	Aralkylamine N-acetyltransferase activity	IBA	21873635
GO:0004059	Function	Aralkylamine N-acetyltransferase activity	IDA	11313340
GO:0004059	Function	Aralkylamine N-acetyltransferase activity	TAS
GO:0004060	Function	Arylamine N-acetyltransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 32296183
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006474	Process	N-terminal protein amino acid acetylation	IDA	11313340
GO:0007623	Process	Circadian rhythm	IBA	21873635
GO:0007623	Process	Circadian rhythm	IMP	12736803
GO:0009416	Process	Response to light stimulus	IBA	21873635
GO:0009648	Process	Photoperiodism	IEA
GO:0010043	Process	Response to zinc ion	IEA
GO:0030187	Process	Melatonin biosynthetic process	IBA	21873635
GO:0030187	Process	Melatonin biosynthetic process	IDA	11313340
GO:0030187	Process	Melatonin biosynthetic process	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0034695	Process	Response to prostaglandin E	IEA
GO:0046219	Process	Indolalkylamine biosynthetic process	TAS
GO:0046688	Process	Response to copper ion	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11313340
GO:0051412	Process	Response to corticosterone	IEA
GO:0051592	Process	Response to calcium ion	IEA
GO:0071320	Process	Cellular response to cAMP	IDA	11313340
GO:0071889	Function	14-3-3 protein binding	IEA

MIM	HGNC	e!Ensembl
600950	19	ENSG00000129673

Protein

UniProt ID

Q16613

Protein name

Serotonin N-acetyltransferase (Serotonin acetylase) (EC 2.3.1.87) (Aralkylamine N-acetyltransferase) (AA-NAT)

Protein function

Controls the night/day rhythm of melatonin production in the pineal gland. Catalyzes the N-acetylation of serotonin into N-acetylserotonin, the penultimate step in the synthesis of melatonin.

PDB

6T80

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00583	Acetyltransf_1	45 → 173	Acetyltransferase (GNAT) family	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in pineal gland and at lower levels in the retina. Weak expression in several brain regions and in the pituitary gland. {ECO:0000269|PubMed:18212399, ECO:0000269|PubMed:8661026}.

Sequence

MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVL
GVCPLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAH
LHVLAVHRAFRQQGRGPILLWRYLHHLGSQPAVRRAALMCEDALVPFYERFSFHAVGPCA
ITVGSLTFMELHCSLRGHPFLRRNSGC

Sequence length

207

Interactions

View interactions

	KEGG		Reactome
	Tryptophan metabolism Metabolic pathways		Serotonin and melatonin biosynthesis

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Advanced sleep phase syndrome	Advanced Sleep Phase Syndrome	rs121908635, rs104894561, rs397514693, rs1559332542	12736803

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Delayed sleep phase syndrome	Delayed Sleep Phase Syndrome	12736803	ClinVar
Mental depression	Mental Depression, Depressive disorder	11316327	ClinVar

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text Mining
Autism Spectrum Disorder	Associate	28522826
Breast Neoplasms	Associate	23822714
Breast Neoplasms	Stimulate	23822714
Colitis Lymphocytic	Stimulate	29382152
Colitis Ulcerative	Stimulate	29382152
Colitis Ulcerative	Associate	38302916
Colorectal Neoplasms	Associate	28604612
Hematologic Diseases	Associate	31815152
Immune System Diseases	Associate	31815152
Lupus Erythematosus Systemic	Associate	31815152
Melanoma	Associate	11821057
Neoplasms	Associate	28604612
Prostatic Neoplasms	Stimulate	28699174

AANAT (aralkylamine N-acetyltransferase)