AANAT (aralkylamine N-acetyltransferase)

Gene

• Entrez ID: 15
• Gene name: Aralkylamine N-acetyltransferase
• Gene symbol: AANAT
• Synonyms (NCBI Gene): DSPS, SNAT
• Chromosome: 17
• Chromosome location: 17q25.1
• Summary: The protein encoded by this gene belongs to the acetyltransferase superfamily. It is the penultimate enzyme in melatonin synthesis and controls the night/day rhythm in melatonin production in the vertebrate pineal gland. Melatonin is essential for the fun

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT054775	hsa-miR-183-5p	Luciferase reporter assay, qRT-PCR	24423866
MIRT736601	hsa-miR-483-3p	Luciferase reporter assay, Northern blotting, qRT-PCR	22908386

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004059	Function	Aralkylamine N-acetyltransferase activity	IBA
GO:0004059	Function	Aralkylamine N-acetyltransferase activity	IDA	11313340
GO:0004059	Function	Aralkylamine N-acetyltransferase activity	IEA
GO:0004059	Function	Aralkylamine N-acetyltransferase activity	TAS
GO:0004060	Function	Arylamine N-acetyltransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006474	Process	N-terminal protein amino acid acetylation	IDA	11313340
GO:0007623	Process	Circadian rhythm	IBA
GO:0007623	Process	Circadian rhythm	IEA
GO:0007623	Process	Circadian rhythm	IMP	12736803
GO:0008080	Function	N-acetyltransferase activity	IEA
GO:0009416	Process	Response to light stimulus	IBA
GO:0009416	Process	Response to light stimulus	IEA
GO:0009648	Process	Photoperiodism	IEA
GO:0010043	Process	Response to zinc ion	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016747	Function	Acyltransferase activity, transferring groups other than amino-acyl groups	IEA
GO:0030187	Process	Melatonin biosynthetic process	IBA
GO:0030187	Process	Melatonin biosynthetic process	IDA	11313340
GO:0030187	Process	Melatonin biosynthetic process	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0034695	Process	Response to prostaglandin E	IEA
GO:0046219	Process	Indolalkylamine biosynthetic process	TAS
GO:0046688	Process	Response to copper ion	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11313340
GO:0048511	Process	Rhythmic process	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0051592	Process	Response to calcium ion	IEA
GO:0071320	Process	Cellular response to cAMP	IDA	11313340
GO:0071889	Function	14-3-3 protein binding	IEA
GO:1901652	Process	Response to peptide	IEA

Other IDs

• MIM: 600950
• HGNC: 19
• e!Ensembl: ENSG00000129673

Protein

• UniProt ID: Q16613
• Protein name: Serotonin N-acetyltransferase (Serotonin acetylase) (EC 2.3.1.87) (Aralkylamine N-acetyltransferase) (AA-NAT)
• Protein function: Controls the night/day rhythm of melatonin production in the pineal gland. Catalyzes the N-acetylation of serotonin into N-acetylserotonin, the penultimate step in the synthesis of melatonin.
• PDB: 6T80
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00583	Acetyltransf_1	45 → 173	Acetyltransferase (GNAT) family	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in pineal gland and at lower levels in the retina. Weak expression in several brain regions and in the pituitary gland. {ECO:0000269|PubMed:18212399, ECO:0000269|PubMed:8661026}.
• Sequence:

  MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVL
  GVCPLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAH
  LHVLAVHRAFRQQGRGPILLWRYLHHLGSQPAVRRAALMCEDALVPFYERFSFHAVGPCA
  ITVGSLTFMELHCSLRGHPFLRRNSGC

• Sequence length: 207

Pathways

KEGG:

Tryptophan metabolism
Metabolic pathways

Reactome:

Serotonin and melatonin biosynthesis

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Delayed sleep phase syndrome, susceptibility to	Uncertain significance	rs28936679	RCV000009162

Associations from Text Mining
Disease Name	Relationship Type	References
Autism Spectrum Disorder	Associate	28522826
Breast Neoplasms	Associate	23822714
Breast Neoplasms	Stimulate	23822714
Colitis Lymphocytic	Stimulate	29382152
Colitis Ulcerative	Stimulate	29382152
Colitis Ulcerative	Associate	38302916
Colorectal Neoplasms	Associate	28604612
Hematologic Diseases	Associate	31815152
Immune System Diseases	Associate	31815152
Lupus Erythematosus Systemic	Associate	31815152
Melanoma	Associate	11821057
Neoplasms	Associate	28604612
Prostatic Neoplasms	Stimulate	28699174