Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1497
Gene name Gene Name - the full gene name approved by the HGNC.
Cystinosin, lysosomal cystine transporter
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CTNS
Synonyms (NCBI Gene) Gene synonyms aliases
CTNS-LSB, PQLC4, SLC66A4
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121908127 G>A Pathogenic Coding sequence variant, missense variant
rs375952052 G>A,C Likely-pathogenic, pathogenic Intron variant
rs1057517330 T>C Likely-pathogenic Stop lost, intron variant, terminator codon variant
rs1555564823 ->G Likely-pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022765 hsa-miR-124-3p Microarray 18668037
MIRT029732 hsa-miR-26b-5p Microarray 19088304
MIRT044666 hsa-miR-320a CLASH 23622248
MIRT650943 hsa-miR-6819-3p HITS-CLIP 23824327
MIRT650942 hsa-miR-6877-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002088 Process Lens development in camera-type eye IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005764 Component Lysosome IDA 11855931, 12138135, 15128704, 18337546
GO:0005764 Component Lysosome IEA
GO:0005765 Component Lysosomal membrane HDA 17897319
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606272 2518 ENSG00000040531
Protein
UniProt ID O60931
Protein name Cystinosin
Protein function Cystine/H(+) symporter that mediates export of cystine, the oxidized dimer of cysteine, from lysosomes (PubMed:11689434, PubMed:15128704, PubMed:18337546, PubMed:22232659, PubMed:29467429, PubMed:33208952, PubMed:36113465). Plays an important ro
PDB 8DKE , 8DKI , 8DKM , 8DKW , 8DKX , 8DYP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04193 PQ-loop 126 186 PQ loop repeat Repeat
PF04193 PQ-loop 265 325 PQ loop repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Strongly expressed in pancreas, kidney (adult and fetal), skeletal muscle, melanocytes and keratinocytes (PubMed:22649030). Expressed at lower levels in placenta and heart. Weakly expressed in lung, liver and brain (adult and fetal) (P
Sequence
MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEI
TFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRS
SAISIINQVIGWIYFVAWSISFYPQVIMNWRRKSVIGLSFDFVALNLTGFVAYSVFNIGL
LWVPYI
KEQFLLKYPNGVNPVNSNDVFFSLHAVVLTLIIIVQCCLYERGGQRVSWPAIGF
LVLAWLFAFVTMIVAAVGVTTWLQFLFCFSYIKLAVTLVKYFPQAYMNFYYKSTEGWSIG
NVLLDFTGGSFSLLQMFLQSYNNDQ
WTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYRKR
PGYDQLN
Sequence length 367
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Lysosome   Transport of inorganic cations/anions and amino acids/oligopeptides
Miscellaneous transport and binding events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Cystinosis cystinosis, Cystinosis, atypical nephropathic rs113994206, rs1555563982, rs759623796, rs786204667, rs121908127, rs879255613, rs893207601, rs113994208, rs879255616, rs776842972, rs760256854, rs121908129, rs550254092, rs113994205, rs267606754
View all (17 more)
N/A
Nephropathic Cystinosis nephropathic cystinosis rs745365232, rs1555563982, rs1475322504, rs786204667, rs1436441738, rs121908127, rs1555562830, rs879255614, rs893207601, rs113994208, rs121908124, rs1597647930, rs1555558116, rs917630768, rs1567695026
View all (50 more)
N/A
Ocular Cystinosis ocular cystinosis rs113994210, rs113994207, rs887657778 N/A
Nephrotic Syndrome nephrotic syndrome rs786204632 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Astrocytoma Pilocytic astrocytoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Cakut Associate 27151922
Cystinosis Associate 10417278, 11505338, 15879904, 20352457, 21786142, 22450360, 22786804, 23640116, 25071085, 25165189, 25866837, 25947233, 26565940, 26915455, 27083281
View all (30 more)
Cystinosis Inhibit 25811383, 26994576
Cystinosis Infantile Nephropathic Associate 33822926
Fanconi Syndrome Associate 15885099, 25165189, 31888107
Kidney Cortex Necrosis Associate 38069326
Lysosomal Storage Diseases Associate 11505338, 33308164
Muscular Dystrophies Associate 33270859
Organizing Pneumonia Associate 25947233
Renal Insufficiency Associate 26915455