Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	149233
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 23 receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL23R
Synonyms (NCBI Gene) Gene synonyms aliases	PSORS7
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p31.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a subunit of the receptor for IL23A/IL23. This protein pairs with the receptor molecule IL12RB1/IL12Rbeta1, and both are required for IL23A signaling. This protein associates constitutively with Janus kinase 2 (JAK2), a

Show/Hide all(210)

miRTarBase ID	miRNA	Experiments	Reference
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT646786	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT646784	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT646785	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT646783	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT646782	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT646781	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT646779	hsa-miR-3666	HITS-CLIP	23824327
MIRT646780	hsa-miR-4295	HITS-CLIP	23824327
MIRT646778	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT646777	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT646776	hsa-miR-148a-3p	HITS-CLIP	23824327
MIRT646775	hsa-miR-148b-3p	HITS-CLIP	23824327
MIRT646774	hsa-miR-152-3p	HITS-CLIP	23824327
MIRT646773	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	Flow, Luciferase reporter assay, qRT-PCR	25863684
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT646786	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT646784	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT646785	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT646783	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT646782	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT646781	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT646779	hsa-miR-3666	HITS-CLIP	23824327
MIRT646780	hsa-miR-4295	HITS-CLIP	23824327
MIRT646778	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT646777	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT646776	hsa-miR-148a-3p	HITS-CLIP	23824327
MIRT646775	hsa-miR-148b-3p	HITS-CLIP	23824327
MIRT646774	hsa-miR-152-3p	HITS-CLIP	23824327
MIRT646773	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT626119	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT626118	hsa-miR-764	HITS-CLIP	23824327
MIRT626117	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT626116	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT626115	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT626114	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT626113	hsa-miR-4777-3p	HITS-CLIP	23824327
MIRT626112	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT626111	hsa-miR-640	HITS-CLIP	23824327
MIRT1064613	hsa-miR-122	CLIP-seq
MIRT1064614	hsa-miR-1279	CLIP-seq
MIRT1064615	hsa-miR-1297	CLIP-seq
MIRT1064616	hsa-miR-1343	CLIP-seq
MIRT1064617	hsa-miR-150	CLIP-seq
MIRT1064618	hsa-miR-1976	CLIP-seq
MIRT1064619	hsa-miR-2052	CLIP-seq
MIRT1064620	hsa-miR-26a	CLIP-seq
MIRT1064621	hsa-miR-26b	CLIP-seq
MIRT1064622	hsa-miR-3126-5p	CLIP-seq
MIRT1064623	hsa-miR-3135b	CLIP-seq
MIRT1064624	hsa-miR-3160-5p	CLIP-seq
MIRT1064625	hsa-miR-3187-3p	CLIP-seq
MIRT1064626	hsa-miR-3652	CLIP-seq
MIRT1064627	hsa-miR-3667-3p	CLIP-seq
MIRT1064628	hsa-miR-3714	CLIP-seq
MIRT1064629	hsa-miR-378	CLIP-seq
MIRT1064630	hsa-miR-378b	CLIP-seq
MIRT1064631	hsa-miR-378c	CLIP-seq
MIRT1064632	hsa-miR-378d	CLIP-seq
MIRT1064633	hsa-miR-378e	CLIP-seq
MIRT1064634	hsa-miR-378f	CLIP-seq
MIRT1064635	hsa-miR-378h	CLIP-seq
MIRT1064636	hsa-miR-378i	CLIP-seq
MIRT1064637	hsa-miR-422a	CLIP-seq
MIRT1064638	hsa-miR-4279	CLIP-seq
MIRT1064639	hsa-miR-4297	CLIP-seq
MIRT1064640	hsa-miR-4419a	CLIP-seq
MIRT1064641	hsa-miR-4423-5p	CLIP-seq
MIRT1064642	hsa-miR-4430	CLIP-seq
MIRT1064643	hsa-miR-4435	CLIP-seq
MIRT1064644	hsa-miR-4465	CLIP-seq
MIRT1064645	hsa-miR-450b-5p	CLIP-seq
MIRT1064646	hsa-miR-4510	CLIP-seq
MIRT1064647	hsa-miR-4668-5p	CLIP-seq
MIRT1064648	hsa-miR-4678	CLIP-seq
MIRT1064649	hsa-miR-4701-5p	CLIP-seq
MIRT1064650	hsa-miR-4708-3p	CLIP-seq
MIRT1064651	hsa-miR-4715-3p	CLIP-seq
MIRT1064652	hsa-miR-4722-3p	CLIP-seq
MIRT1064653	hsa-miR-4755-3p	CLIP-seq
MIRT1064654	hsa-miR-507	CLIP-seq
MIRT1064655	hsa-miR-548s	CLIP-seq
MIRT1064656	hsa-miR-557	CLIP-seq
MIRT1064657	hsa-miR-562	CLIP-seq
MIRT1064658	hsa-miR-588	CLIP-seq
MIRT1064613	hsa-miR-122	CLIP-seq
MIRT2015373	hsa-miR-216a	CLIP-seq
MIRT1064623	hsa-miR-3135b	CLIP-seq
MIRT1064626	hsa-miR-3652	CLIP-seq
MIRT1064641	hsa-miR-4423-5p	CLIP-seq
MIRT1064642	hsa-miR-4430	CLIP-seq
MIRT2015374	hsa-miR-668	CLIP-seq
MIRT1064613	hsa-miR-122	CLIP-seq
MIRT1064615	hsa-miR-1297	CLIP-seq
MIRT1064616	hsa-miR-1343	CLIP-seq
MIRT1064618	hsa-miR-1976	CLIP-seq
MIRT2015373	hsa-miR-216a	CLIP-seq
MIRT1064620	hsa-miR-26a	CLIP-seq
MIRT1064621	hsa-miR-26b	CLIP-seq
MIRT1064623	hsa-miR-3135b	CLIP-seq
MIRT1064626	hsa-miR-3652	CLIP-seq
MIRT1064627	hsa-miR-3667-3p	CLIP-seq
MIRT1064638	hsa-miR-4279	CLIP-seq
MIRT1064639	hsa-miR-4297	CLIP-seq
MIRT1064641	hsa-miR-4423-5p	CLIP-seq
MIRT1064642	hsa-miR-4430	CLIP-seq
MIRT1064644	hsa-miR-4465	CLIP-seq
MIRT2389366	hsa-miR-28-5p	CLIP-seq
MIRT2389367	hsa-miR-3139	CLIP-seq
MIRT2389368	hsa-miR-708	CLIP-seq
MIRT1064613	hsa-miR-122	CLIP-seq
MIRT2451749	hsa-miR-1324	CLIP-seq
MIRT2451750	hsa-miR-2054	CLIP-seq
MIRT1064623	hsa-miR-3135b	CLIP-seq
MIRT1064626	hsa-miR-3652	CLIP-seq
MIRT2451751	hsa-miR-411	CLIP-seq
MIRT1064641	hsa-miR-4423-5p	CLIP-seq
MIRT1064642	hsa-miR-4430	CLIP-seq
MIRT1064651	hsa-miR-4715-3p	CLIP-seq
MIRT2451752	hsa-miR-4735-5p	CLIP-seq
MIRT2451753	hsa-miR-4743	CLIP-seq
MIRT2451754	hsa-miR-4775	CLIP-seq
MIRT2451755	hsa-miR-4797-5p	CLIP-seq
MIRT2451756	hsa-miR-590-3p	CLIP-seq
MIRT1064613	hsa-miR-122	CLIP-seq
MIRT1064615	hsa-miR-1297	CLIP-seq
MIRT2451749	hsa-miR-1324	CLIP-seq
MIRT1064616	hsa-miR-1343	CLIP-seq
MIRT1064618	hsa-miR-1976	CLIP-seq
MIRT1064620	hsa-miR-26a	CLIP-seq
MIRT1064621	hsa-miR-26b	CLIP-seq
MIRT1064623	hsa-miR-3135b	CLIP-seq
MIRT1064626	hsa-miR-3652	CLIP-seq
MIRT1064627	hsa-miR-3667-3p	CLIP-seq
MIRT1064638	hsa-miR-4279	CLIP-seq
MIRT1064639	hsa-miR-4297	CLIP-seq
MIRT1064641	hsa-miR-4423-5p	CLIP-seq
MIRT1064642	hsa-miR-4430	CLIP-seq
MIRT1064644	hsa-miR-4465	CLIP-seq
MIRT1064652	hsa-miR-4722-3p	CLIP-seq
MIRT2451755	hsa-miR-4797-5p	CLIP-seq
MIRT1064613	hsa-miR-122	CLIP-seq
MIRT2451749	hsa-miR-1324	CLIP-seq
MIRT1064623	hsa-miR-3135b	CLIP-seq
MIRT1064626	hsa-miR-3652	CLIP-seq
MIRT1064641	hsa-miR-4423-5p	CLIP-seq
MIRT1064642	hsa-miR-4430	CLIP-seq
MIRT2451755	hsa-miR-4797-5p	CLIP-seq

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	12421946
GO:0002230	Process	Positive regulation of defense response to virus by host	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IDA	15114670
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	ISS
GO:0004896	Function	Cytokine receptor activity	IDA	29287995
GO:0004925	Function	Prolactin receptor activity	IBA
GO:0005143	Function	Interleukin-12 receptor binding	IBA
GO:0005143	Function	Interleukin-12 receptor binding	IPI	12023369
GO:0005515	Function	Protein binding	IPI	12023369, 25416956
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IC	12023369
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	12023369
GO:0016020	Component	Membrane	IEA
GO:0017046	Function	Peptide hormone binding	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019955	Function	Cytokine binding	IBA
GO:0032496	Process	Response to lipopolysaccharide	IDA	12023369
GO:0032693	Process	Negative regulation of interleukin-10 production	IMP	16751425
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IC	20027291
GO:0032729	Process	Positive regulation of type II interferon production	IC	20027291
GO:0032729	Process	Positive regulation of type II interferon production	IDA	11114383
GO:0032729	Process	Positive regulation of type II interferon production	TAS	19088061
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	20027291
GO:0032740	Process	Positive regulation of interleukin-17 production	IC	17888176
GO:0032819	Process	Positive regulation of natural killer cell proliferation	TAS	19088061
GO:0034341	Process	Response to type II interferon	IDA	12023369
GO:0038155	Process	Interleukin-23-mediated signaling pathway	IDA	7528775, 12023369, 29287995
GO:0038155	Process	Interleukin-23-mediated signaling pathway	IDA	29287995
GO:0038161	Process	Prolactin signaling pathway	IEA
GO:0042019	Function	Interleukin-23 binding	IBA
GO:0042019	Function	Interleukin-23 binding	IPI	12023369
GO:0042020	Function	Interleukin-23 receptor activity	IDA	12023369
GO:0042102	Process	Positive regulation of T cell proliferation	IC	12023369
GO:0042104	Process	Positive regulation of activated T cell proliferation	IC	11114383
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043382	Process	Positive regulation of memory T cell differentiation	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IC	17888176
GO:0050829	Process	Defense response to Gram-negative bacterium	IC	15114670
GO:0051135	Process	Positive regulation of NK T cell activation	TAS	19088061
GO:0072536	Component	Interleukin-23 receptor complex	IBA
GO:0072536	Component	Interleukin-23 receptor complex	IDA	12023369
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	TAS	19088061
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	ISS
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	ISS

MIM	HGNC	e!Ensembl
607562	19100	ENSG00000162594

Protein

UniProt ID

Q5VWK5

Protein name

Interleukin-23 receptor (IL-23 receptor) (IL-23R)

Protein function

Associates with IL12RB1 to form the interleukin-23 receptor. Binds IL23 and mediates T-cells, NK cells and possibly certain macrophage/myeloid cells stimulation probably through activation of the Jak-Stat signaling cascade. IL23 functions in inn

PDB

5MZV , 6WDQ , 8OE4

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed by monocytes, Th1, Th0, NK and dendritic cells. Isoform 1 is specifically expressed in NK cells. {ECO:0000269|PubMed:12023369, ECO:0000269|PubMed:16372191}.

Sequence

MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDIS
SGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYIN
ISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTII
YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETG
KRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGM
IVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMN
NNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENTGPLETRDYPQNSLFDNTTVVYIPDL
NTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLDSGNNPRLQKHPNFAFSVSSVNSL
SNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGI
VNEELPSINTYFPQNILESHFNRISLLEK

Sequence length

629

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway Th17 cell differentiation Pathways in cancer Inflammatory bowel disease		Interleukin-4 and Interleukin-13 signaling Interleukin-23 signaling

Show/Hide Unknown Diseases (8)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Ankylosing Spondylitis	Ankylosing spondylitis	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes (age of onset)	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease, Inflammatory bowel disease and other gasteroenteritis and colitis (PheCode 555), Inflammatory bowel disease (MTAG)	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Psoriasis vulgaris	Psoriasis vulgaris	N/A	N/A	GWAS
Sarcoidosis	Sarcoidosis	N/A	N/A	GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (119)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acanthamoeba Keratitis	Associate	33755043
Adenocarcinoma	Associate	28102292
Adenoma	Associate	22154103
Anemia Aplastic	Associate	19165485
Arthritis	Associate	30299251
Arthritis Juvenile	Associate	21281511
Arthritis Psoriatic	Associate	18369459, 18800148, 19035472, 21281511, 22298274, 24286492, 25651891, 27543964, 31677365
Arthritis Rheumatoid	Associate	18073300, 18369459, 19021011, 20929536, 26062018, 28547498
Arthritis Rheumatoid	Inhibit	28547498
Asthma	Associate	26547706
Atherosclerosis	Associate	25192515
Autoimmune Diseases	Associate	18073300, 19021011, 19165485, 19522770, 19918037, 21508257, 21606346, 21846945, 22022372, 24312163, 24395888, 24912586, 26228217, 31123953
Behcet Syndrome	Associate	22378604, 22385240, 23633568, 24286189, 26222305, 27548383, 29017598, 33393726
Behcet Syndrome	Stimulate	26785681
Breast Neoplasms	Associate	17952073, 23239971
Carcinogenesis	Associate	22154103
Carcinoma Hepatocellular	Associate	29864461, 34190694
Carcinoma Non Small Cell Lung	Stimulate	32020720
Cavitary Optic Disc Anomalies	Associate	26626589
CD59 Deficiency	Associate	18045485, 21364948
Celiac Disease	Associate	18369459, 19175939
Chronic Disease	Associate	19175939, 26887945
Chronic Periodontitis	Associate	32267379
Colitis Associated Neoplasms	Associate	36232773
Colitis Ulcerative	Associate	17484863, 17786191, 18698678, 19122664, 19175939, 21830272, 22022372, 22154103, 22269043, 22735800, 22984500, 24068945, 24382939, 24415875, 24971461 View all (6 more)
Colitis Ulcerative	Stimulate	18438406
Colonic Diseases	Associate	21079743, 21830272, 23300620
Colorectal Neoplasms	Associate	22154103, 25015728, 26083022, 36232773
Coronary Artery Disease	Associate	24699314, 25192515, 31074535
Coxa Magna	Associate	18779654, 28422712
Crohn Disease	Associate	17068223, 17309073, 17447842, 17484863, 17618837, 17786191, 17804789, 18073300, 18383363, 18438406, 18470928, 18521914, 18698678, 18715515, 19021011 View all (42 more)
Crohn Disease	Stimulate	19273624, 24382939
Crohn Disease	Inhibit	21983784
Death	Associate	30833806
Demyelinating Diseases	Associate	27893410
Diabetes Mellitus Type 1	Associate	26887945
Diabetes Mellitus Type 2	Associate	37123139
Digestive System Neoplasms	Associate	23239971
Disease	Associate	17952073
Esophageal Squamous Cell Carcinoma	Associate	24586528
Essential Hypertension	Associate	28682143
Familial antiphospholipid syndrome	Associate	27320770
Fibrosis	Associate	19918037
Fibrous Dysplasia Polyostotic	Associate	31819081
Fuchs' Endothelial Dystrophy	Associate	21151597
Gastritis	Associate	26151690, 33402994
Glioblastoma	Associate	34412691
Gout	Associate	26399911, 31738005
Graft vs Host Disease	Stimulate	23792271
Graft vs Host Disease	Associate	29142307
Granulomatosis Orofacial	Associate	27306066
Graves Disease	Associate	18073300, 19021011
Graves Ophthalmopathy	Associate	18073300, 19021011, 22663548
Hashimoto Disease	Associate	26228217
Hematologic Neoplasms	Associate	23393581
Hepatitis B	Associate	34190694
Hypertension	Associate	25192515
Hypertension Pulmonary	Associate	19918037
Hypertrophy Left Ventricular	Associate	25329069
Ileal Diseases	Associate	17786191
Immune Reconstitution Inflammatory Syndrome	Associate	24912586
Immune System Diseases	Associate	23696856
Infarction	Associate	30641535
Infections	Associate	26626589
Inflammation	Associate	21606346, 22154103, 22984500, 24395888, 24586528, 24971461, 25192515, 26083022, 26222305, 26547706, 28102292, 30646942, 30972071, 31097538, 33402994, 37600767 View all (1 more)
Inflammatory Bowel Disease 5	Associate	22440928
Inflammatory Bowel Diseases	Associate	17068223, 17309073, 17484863, 17618837, 17786191, 18383363, 18698678, 19103525, 19165485, 19175939, 19877036, 19918037, 20066736, 21088407, 21151126 View all (24 more)
Inflammatory Bowel Diseases	Inhibit	21983784, 27458846
Intestinal Diseases	Associate	29142307
Iron Deficiencies	Associate	28210080
Keratitis Ichthyosis Deafness Syndrome	Associate	30150638
Laryngeal Neoplasms	Associate	30355949
Latent Tuberculosis	Inhibit	29996789
Leprosy	Associate	28842327
Leukemia Biphenotypic Acute	Associate	28341819
Leukemia Myeloid Acute	Associate	23393581, 24793548, 26191290
Liver Cirrhosis Biliary	Associate	24375552
Lung Diseases	Associate	22695161
Lung Diseases Interstitial	Associate	30641535
Lupus Erythematosus Systemic	Stimulate	21110900
Lupus Erythematosus Systemic	Associate	27320770
Lymphatic Metastasis	Associate	22173670
Lymphatic Metastasis	Inhibit	25015728
Lymphoma Large Cell Anaplastic	Associate	29588546
Malaria	Associate	28427357
Multiple Sclerosis	Associate	17952073, 22182694, 27893410, 33037101
Mycoses	Associate	37123139
Neoplasms	Associate	23239971, 23393581, 24586528, 25015728, 26083022, 30355949, 32020720, 36232773
Neuroinflammatory Diseases	Associate	27893410
Parkinson Disease	Associate	32884248
Pemphigoid Bullous	Associate	33340282
Pemphigus	Associate	30116153
Pre Eclampsia	Associate	31123953
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	28341819
Prodromal Symptoms	Associate	29864461
Psoriasis	Associate	18369459, 18383363, 18614543, 18800148, 19035472, 19169254, 19175939, 19877036, 21364948, 21846945, 22022372, 22298274, 23750651, 24286492, 26887945, 38301504 View all (1 more)
Purpura Thrombocytopenic Idiopathic	Stimulate	25621490
Rectal Neoplasms	Associate	22154103
Rhinitis Allergic	Associate	23696856
Sacroiliitis	Associate	23818276
Sarcoidosis	Associate	20650992, 21846945, 26051272, 27306066
Schistosomiasis	Associate	24912586
Scleroderma Systemic	Associate	19536281, 19918037, 30641535
Severe Acute Respiratory Syndrome	Associate	28427357, 33755043
Short Bowel Syndrome	Associate	28210080
Smoke Inhalation Injury	Associate	31819081
Spondylitis Ankylosing	Associate	17952073, 18383363, 19522770, 19877036, 20062062, 20463747, 21248258, 21364948, 21846945, 22144400, 23606107, 23818276, 23840727, 24998354, 26916345, 28381868, 30646942, 40349828 View all (3 more)
Spondylitis Ankylosing	Stimulate	39185422
Status Asthmaticus	Associate	26547706
Stomach Neoplasms	Associate	29118466, 30833806
Thrombosis	Associate	29864461
Thyroiditis Autoimmune	Associate	19021011, 35767887
Tuberculosis	Associate	22695161
Tuberculosis Meningeal	Associate	29996789
Tuberculosis Pulmonary	Associate	22695161, 26626589, 36483566
Uveitis	Associate	21846945, 23840727
Uveitis Anterior	Associate	24312163, 25200001
Uveomeningoencephalitic Syndrome	Associate	32437414
Weight Loss	Associate	28210080

IL23R (interleukin 23 receptor)