Gene Gene information from NCBI Gene database.
Entrez ID 149111
Gene name Cornichon family AMPA receptor auxiliary protein 3
Gene symbol CNIH3
Synonyms (NCBI Gene)
CNIH-3
Chromosome 1
Chromosome location 1q42.12
miRNA miRNA information provided by mirtarbase database.
62
miRTarBase ID miRNA Experiments Reference
MIRT017447 hsa-miR-335-5p Microarray 18185580
MIRT899697 hsa-miR-1207-3p CLIP-seq
MIRT899698 hsa-miR-188-3p CLIP-seq
MIRT899699 hsa-miR-1915 CLIP-seq
MIRT899700 hsa-miR-329 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IBA
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005789 Component Endoplasmic reticulum membrane TAS
GO:0005886 Component Plasma membrane IEA
GO:0012507 Component ER to Golgi transport vesicle membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TBE1
Protein name Protein cornichon homolog 3 (CNIH-3) (Cornichon family AMPA receptor auxiliary protein 3)
Protein function Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by regulating their rates of activation, deactivatio
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03311 Cornichon 7 51 Cornichon protein Family
PF03311 Cornichon 50 151 Cornichon protein Family
Tissue specificity TISSUE SPECIFICITY: Expression is up-regulated in dorsolateral prefrontal cortex of patients with schizophrenia (postmortem brain study). {ECO:0000269|PubMed:23103966}.
Sequence
MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERI
CFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPP
VVMNADTLSYCQKEAWCKLAFYLLSFFYYLY
CMIYTLVSS
Sequence length 160
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    COPII-mediated vesicle transport
Cargo concentration in the ER