CCN2 (cellular communication network factor 2)

Gene

• Entrez ID: 1490
• Gene name: Cellular communication network factor 2
• Gene symbol: CCN2
• Synonyms (NCBI Gene): CTGF, HCS24, IBP-8, IGFBP8, KMD, NOV2, SEMDLSL
• Chromosome: 6
• Chromosome location: 6q23.2
• Summary: The protein encoded by this gene is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth fa

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT735783	hsa-miR-18a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32656212

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001502	Process	Cartilage condensation	IEA
GO:0001503	Process	Ossification	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001649	Process	Osteoblast differentiation	IMP	39414788
GO:0001894	Process	Tissue homeostasis	IEA
GO:0002062	Process	Chondrocyte differentiation	IEA
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IEA
GO:0005515	Function	Protein binding	IPI	9927660, 16457822, 21629692, 30232710
GO:0005520	Function	Insulin-like growth factor binding	TAS	9371786
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	39414788
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	TAS	10809757
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0008201	Function	Heparin binding	IBA
GO:0008201	Function	Heparin binding	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008544	Process	Epidermis development	TAS	10809757
GO:0009611	Process	Response to wounding	TAS	10809757
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0016477	Process	Cell migration	IEA
GO:0030324	Process	Lung development	IEA
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	IBA
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	TAS	10809757
GO:0032330	Process	Regulation of chondrocyte differentiation	IEA
GO:0035988	Process	Chondrocyte proliferation	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IBA
GO:0045597	Process	Positive regulation of cell differentiation	IDA	20008146
GO:0046330	Process	Positive regulation of JNK cascade	IDA	20008146
GO:0050793	Process	Regulation of developmental process	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IDA	20008146
GO:0061448	Process	Connective tissue development	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	20008146
GO:0071897	Process	DNA biosynthetic process	IEA
GO:0071944	Component	Cell periphery	IEA
GO:0072593	Process	Reactive oxygen species metabolic process	IEA

Other IDs

• MIM: 121009
• HGNC: 2500
• e!Ensembl: ENSG00000118523

Protein

• UniProt ID: P29279
• Protein name: CCN family member 2 (Cellular communication network factor 2) (Connective tissue growth factor) (Hypertrophic chondrocyte-specific protein 24) (Insulin-like growth factor-binding protein 8) (IBP-8) (IGF-binding protein 8) (IGFBP-8)
• Protein function: Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Is involved in the stimulation of osteoblast differentiation and has a critical role in osteogenesis (PubM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00219	IGFBP	27 → 82	Insulin-like growth factor binding protein	Domain
  PF00093	VWC	103 → 166	von Willebrand factor type C domain	Family
  PF19035	TSP1_CCN	199 → 242	CCN3 Nov like TSP1 domain	Domain
  PF00007	Cys_knot	253 → 346	Cystine-knot domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in bone marrow and thymic cells. Also expressed one of two Wilms tumors tested. {ECO:0000269|PubMed:1756408}.
• Sequence:

  MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
  AKQLGELCTERDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC
  KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
  AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
  PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
  LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

• Sequence length: 349

Pathways

KEGG:

Apelin signaling pathway
Hippo signaling pathway

Reactome:

YAP1- and WWTR1 (TAZ)-stimulated gene expression
RUNX3 regulates YAP1-mediated transcription