Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1489
Gene name Gene Name - the full gene name approved by the HGNC.
Cardiotrophin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CTF1
Synonyms (NCBI Gene) Gene synonyms aliases
CT-1, CT1
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a secreted cytokine that induces cardiac myocyte hypertrophy in vitro. It has been shown to bind and activate the ILST/gp130 receoptor. Two transcript variants encoding different isoforms have been found for this gene.
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT914603 hsa-miR-1178 CLIP-seq
MIRT914604 hsa-miR-1273 CLIP-seq
MIRT914605 hsa-miR-1273f CLIP-seq
MIRT914606 hsa-miR-1285 CLIP-seq
MIRT914607 hsa-miR-1324 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IBA
GO:0005125 Function Cytokine activity IEA
GO:0005146 Function Leukemia inhibitory factor receptor binding TAS 8833032
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005576 Component Extracellular region IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600435 2499 ENSG00000150281
Protein
UniProt ID Q16619
Protein name Cardiotrophin-1 (CT-1)
Protein function Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart, skeletal muscle, prostate and ovary. Lower levels in lung, kidney, pancreas, thymus, testis and small intestine. Little or no expression in brain, placenta, liver, spleen, colon or peripheral blood leukocytes
Sequence
MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPS
FSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLR
RLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGL
YREWLSRTEGDLGQLLPGGSA
Sequence length 201
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
  IL-6-type cytokine receptor ligand interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
cardiomyopathy Cardiomyopathy N/A N/A ClinVar
Cardiomyopathy Primary dilated cardiomyopathy N/A N/A ClinVar
Dilated Cardiomyopathy Dilated Cardiomyopathy, Dominant N/A N/A ClinVar
Hypertrophic cardiomyopathy hypertrophic cardiomyopathy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34301211
Atherosclerosis Associate 18055523, 23935888
Brain Ischemia Associate 25732979
Cardiomyopathy Hypertrophic Stimulate 16920889
Diabetes Mellitus Inhibit 25025664
Diabetes Mellitus Type 2 Associate 23776558
Drug Related Side Effects and Adverse Reactions Inhibit 17970078
Essential Hypertension Associate 33813485
Heart Failure Stimulate 17885560
Heart Failure Associate 23041742, 33813485