Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1489
Gene name	Cardiotrophin 1
Gene symbol	CTF1
Synonyms (NCBI Gene)	CT-1CT1
Chromosome	16
Chromosome location	16p11.2
Summary	The protein encoded by this gene is a secreted cytokine that induces cardiac myocyte hypertrophy in vitro. It has been shown to bind and activate the ILST/gp130 receoptor. Two transcript variants encoding different isoforms have been found for this gene.

Show/Hide all (99)

miRTarBase ID	miRNA	Experiments
MIRT914603	hsa-miR-1178	CLIP-seq
MIRT914604	hsa-miR-1273	CLIP-seq
MIRT914605	hsa-miR-1273f	CLIP-seq
MIRT914606	hsa-miR-1285	CLIP-seq
MIRT914607	hsa-miR-1324	CLIP-seq
MIRT914608	hsa-miR-143	CLIP-seq
MIRT914609	hsa-miR-2110	CLIP-seq
MIRT914610	hsa-miR-2114	CLIP-seq
MIRT914611	hsa-miR-2278	CLIP-seq
MIRT914612	hsa-miR-3150a-5p	CLIP-seq
MIRT914613	hsa-miR-3150b-5p	CLIP-seq
MIRT914614	hsa-miR-3166	CLIP-seq
MIRT914615	hsa-miR-3187-5p	CLIP-seq
MIRT914616	hsa-miR-3197	CLIP-seq
MIRT914617	hsa-miR-342-3p	CLIP-seq
MIRT914618	hsa-miR-3714	CLIP-seq
MIRT914619	hsa-miR-377	CLIP-seq
MIRT914620	hsa-miR-3918	CLIP-seq
MIRT914621	hsa-miR-4271	CLIP-seq
MIRT914622	hsa-miR-4468	CLIP-seq
MIRT914623	hsa-miR-4486	CLIP-seq
MIRT914624	hsa-miR-4643	CLIP-seq
MIRT914625	hsa-miR-4649-3p	CLIP-seq
MIRT914626	hsa-miR-4649-5p	CLIP-seq
MIRT914627	hsa-miR-466	CLIP-seq
MIRT914628	hsa-miR-4667-5p	CLIP-seq
MIRT914629	hsa-miR-4700-5p	CLIP-seq
MIRT914630	hsa-miR-4708-5p	CLIP-seq
MIRT914631	hsa-miR-4725-3p	CLIP-seq
MIRT914632	hsa-miR-4725-5p	CLIP-seq
MIRT914633	hsa-miR-4731-5p	CLIP-seq
MIRT914634	hsa-miR-4770	CLIP-seq
MIRT914635	hsa-miR-4789-3p	CLIP-seq
MIRT914636	hsa-miR-504	CLIP-seq
MIRT914637	hsa-miR-597	CLIP-seq
MIRT914638	hsa-miR-612	CLIP-seq
MIRT914639	hsa-miR-661	CLIP-seq
MIRT914640	hsa-miR-940	CLIP-seq
MIRT914641	hsa-miR-1225-3p	CLIP-seq
MIRT914642	hsa-miR-1233	CLIP-seq
MIRT914643	hsa-miR-1304	CLIP-seq
MIRT914607	hsa-miR-1324	CLIP-seq
MIRT914644	hsa-miR-1827	CLIP-seq
MIRT914645	hsa-miR-2277-3p	CLIP-seq
MIRT914646	hsa-miR-2467-5p	CLIP-seq
MIRT914647	hsa-miR-2682	CLIP-seq
MIRT914614	hsa-miR-3166	CLIP-seq
MIRT914648	hsa-miR-3188	CLIP-seq
MIRT914649	hsa-miR-3192	CLIP-seq
MIRT914650	hsa-miR-34a	CLIP-seq
MIRT914651	hsa-miR-34c-5p	CLIP-seq
MIRT914652	hsa-miR-3612	CLIP-seq
MIRT914653	hsa-miR-3689a-3p	CLIP-seq
MIRT914654	hsa-miR-3689c	CLIP-seq
MIRT914655	hsa-miR-3689d	CLIP-seq
MIRT914656	hsa-miR-3944-5p	CLIP-seq
MIRT914657	hsa-miR-3975	CLIP-seq
MIRT914658	hsa-miR-4459	CLIP-seq
MIRT914622	hsa-miR-4468	CLIP-seq
MIRT914659	hsa-miR-449a	CLIP-seq
MIRT914660	hsa-miR-449b	CLIP-seq
MIRT914661	hsa-miR-449c	CLIP-seq
MIRT914662	hsa-miR-4728-5p	CLIP-seq
MIRT914633	hsa-miR-4731-5p	CLIP-seq
MIRT914663	hsa-miR-485-5p	CLIP-seq
MIRT914664	hsa-miR-512-3p	CLIP-seq
MIRT914665	hsa-miR-650	CLIP-seq
MIRT914666	hsa-miR-665	CLIP-seq
MIRT1971354	hsa-miR-3130-3p	CLIP-seq
MIRT1971355	hsa-miR-4252	CLIP-seq
MIRT914639	hsa-miR-661	CLIP-seq
MIRT914641	hsa-miR-1225-3p	CLIP-seq
MIRT914642	hsa-miR-1233	CLIP-seq
MIRT914604	hsa-miR-1273	CLIP-seq
MIRT1971354	hsa-miR-3130-3p	CLIP-seq
MIRT1971355	hsa-miR-4252	CLIP-seq
MIRT914623	hsa-miR-4486	CLIP-seq
MIRT914626	hsa-miR-4649-5p	CLIP-seq
MIRT914639	hsa-miR-661	CLIP-seq
MIRT914606	hsa-miR-1285	CLIP-seq
MIRT914615	hsa-miR-3187-5p	CLIP-seq
MIRT914638	hsa-miR-612	CLIP-seq
MIRT914639	hsa-miR-661	CLIP-seq
MIRT914612	hsa-miR-3150a-5p	CLIP-seq
MIRT914613	hsa-miR-3150b-5p	CLIP-seq
MIRT2510188	hsa-miR-1283	CLIP-seq
MIRT914612	hsa-miR-3150a-5p	CLIP-seq
MIRT914613	hsa-miR-3150b-5p	CLIP-seq
MIRT2510189	hsa-miR-3613-3p	CLIP-seq
MIRT2510190	hsa-miR-4684-5p	CLIP-seq
MIRT2510188	hsa-miR-1283	CLIP-seq
MIRT914606	hsa-miR-1285	CLIP-seq
MIRT914612	hsa-miR-3150a-5p	CLIP-seq
MIRT914613	hsa-miR-3150b-5p	CLIP-seq
MIRT914615	hsa-miR-3187-5p	CLIP-seq
MIRT2510189	hsa-miR-3613-3p	CLIP-seq
MIRT2510190	hsa-miR-4684-5p	CLIP-seq
MIRT914638	hsa-miR-612	CLIP-seq
MIRT914639	hsa-miR-661	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005146	Function	Leukemia inhibitory factor receptor binding	TAS	8833032
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	7862649
GO:0005615	Component	Extracellular space	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007267	Process	Cell-cell signaling	TAS	7862649
GO:0007399	Process	Nervous system development	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0007517	Process	Muscle organ development	TAS	7862649, 8833032
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	7862649
GO:0030182	Process	Neuron differentiation	TAS	7738033
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	21912637
GO:0048666	Process	Neuron development	IEA

MIM	HGNC	e!Ensembl
600435	2499	ENSG00000150281

Q16619

Protein name

Cardiotrophin-1 (CT-1)

Protein function

Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart, skeletal muscle, prostate and ovary. Lower levels in lung, kidney, pancreas, thymus, testis and small intestine. Little or no expression in brain, placenta, liver, spleen, colon or peripheral blood leukocytes

Sequence

MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPS
FSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLR
RLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGL
YREWLSRTEGDLGQLLPGGSA

Sequence length

201

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway		IL-6-type cytokine receptor ligand interactions

185

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cardiomyopathy	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	rs1373635087, rs1162513328, rs1382940759, rs727502948, rs982347034, rs397516644, rs8059269, rs397516648, rs397516652, rs936775298, rs1217608616, rs1192760025, rs776753331	RCV001799274 RCV001799275 RCV001799276 RCV000852713 RCV003150760 RCV000770523 RCV000770519 RCV003149633 RCV000770522 RCV000770520 RCV000770521 RCV001170351 RCV001170352
CTF1-related disorder	Uncertain significance	rs397516644	RCV003934905
Dilated Cardiomyopathy, Dominant	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	rs1332064376, rs1324790071, rs2143247242, rs1377343246, rs1384722765, rs1596639693, rs772604974, rs1179040083, rs1194218989, rs1026759136, rs1405204256, rs1443088980, rs11862962, rs1373635087, rs1382940759 View all (128 more)	RCV001318485 RCV001358993 RCV001373097 RCV001367437 RCV001410873 RCV001408895 RCV001413901 RCV001398099 RCV001428156 RCV001426541 RCV001459882 RCV001506596 RCV001509673 RCV003591893 RCV002034667 RCV002034267 RCV001990366 RCV002028574 RCV001940552 RCV001992577 RCV002025523 RCV001914409 RCV001883452 RCV001911215 RCV002039987 RCV002014696 RCV001957457 RCV001899195 RCV001880418 RCV002036293 RCV001936926 RCV001965906 RCV001895088 RCV002156862 RCV002139322 RCV002177751 RCV002113640 RCV002168764 RCV002154367 RCV002112658 RCV002191963 RCV002177810 RCV002111587 RCV002217384 RCV002172280 RCV000537947 RCV001497897 RCV003053013 RCV003064873 RCV003064781 RCV003078881 RCV003081897 RCV003071806 RCV003090398 RCV003087970 RCV002588069 RCV002632577 RCV002588414 RCV002633183 RCV002624787 RCV002651887 RCV003109193 RCV003118781 RCV003118860 RCV002640009 RCV002653843 RCV002726461 RCV002745870 RCV002800143 RCV002785947 RCV002771165 RCV002837485 RCV002866741 RCV002889486 RCV002909422 RCV002975213 RCV002982663 RCV002979815 RCV002995360 RCV003025531 RCV003025979 RCV003030234 RCV003024390 RCV001853440 RCV003592855 RCV003593096 RCV003593244 RCV003592891 RCV003593353 RCV003591596 RCV003755110 RCV003755113 RCV003755254 RCV003755438 RCV003755551 RCV003755652 RCV003755703 RCV003755659 RCV003755803 RCV003755915 RCV003756007 RCV003756087 RCV003756026 RCV003756136 RCV003756380 RCV003756312 RCV003756364 RCV003756547 RCV003756590 RCV003756494 RCV003756585 RCV003829175 RCV003849549 RCV003863281 RCV001488039 RCV000320158 RCV000261532 RCV000320966 RCV001506485 RCV000375605 RCV000557718 RCV000533765 RCV000550779 RCV000527347 RCV000655485 RCV000655486 RCV000324394 RCV001477216 RCV000655492 RCV002513472 RCV000557357 RCV000545312 RCV000335766 RCV000697728 RCV000685213 RCV000687018 RCV000692197 RCV001869069 RCV002067218 RCV000817348 RCV000811805 RCV000811017 RCV000791711 RCV000793504 RCV001869287 RCV001447819 RCV000867806 RCV002065667 RCV001066695 RCV001054892 RCV005093717 RCV001502299 RCV001236003 RCV001242998 RCV001298337 RCV001301452 RCV001294619 RCV001294514 RCV001295489 RCV001295754 RCV001298018
Hypertrophic cardiomyopathy	Conflicting classifications of pathogenicity; Uncertain significance	rs727502949, rs1567331279	RCV000852714 RCV000999586
Primary dilated cardiomyopathy	Uncertain significance	rs1218236539	RCV000850341
Primary familial hypertrophic cardiomyopathy	Conflicting classifications of pathogenicity	rs2234933	RCV000157154

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	34301211
Atherosclerosis	Associate	18055523, 23935888
Brain Ischemia	Associate	25732979
Cardiomyopathy Hypertrophic	Stimulate	16920889
Diabetes Mellitus	Inhibit	25025664
Diabetes Mellitus Type 2	Associate	23776558
Drug Related Side Effects and Adverse Reactions	Inhibit	17970078
Essential Hypertension	Associate	33813485
Heart Failure	Stimulate	17885560
Heart Failure	Associate	23041742, 33813485
Heart Valve Diseases	Associate	25732979
Hypertension	Associate	17885560
Hypertrophy	Associate	33813485
Hypertrophy Left Ventricular	Associate	33813485
Idiopathic Pulmonary Fibrosis	Associate	37858084
Insulin Resistance	Associate	25025664
Migraine Disorders	Associate	33813485
Multiple Endocrine Neoplasia Type 2a	Associate	33813485
Neoplasms	Associate	23220842
Neuromuscular Diseases	Associate	23776558

CTF1 (cardiotrophin 1)