Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
148789
Gene name Gene Name - the full gene name approved by the HGNC.
Beta-1,3-N-acetylgalactosaminyltransferase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
B3GALNT2
Synonyms (NCBI Gene) Gene synonyms aliases
B3GalNAc-T2, MDDGA11
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MDDGA11
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q42.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the glycosyltransferase 31 family. The encoded protein synthesizes GalNAc:beta-1,3GlcNAc, a novel carbohydrate structure, on N- and O-glycans. Alternatively spliced transcript variants that encode different isoforms have been
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs142756842 C>T Likely-pathogenic, likely-benign Coding sequence variant, non coding transcript variant, missense variant
rs201345883 C>A,G,T Conflicting-interpretations-of-pathogenicity Non coding transcript variant, missense variant, coding sequence variant
rs201822310 C>G Likely-pathogenic Non coding transcript variant, missense variant, coding sequence variant
rs367543069 ->AGCCGCAGCCAGAGGTGCAGCGC Not-provided, pathogenic Non coding transcript variant, coding sequence variant, frameshift variant
rs367543070 CA>- Pathogenic, not-provided Non coding transcript variant, coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT705299 hsa-miR-4537 HITS-CLIP 23313552
MIRT705298 hsa-miR-6499-3p HITS-CLIP 23313552
MIRT488482 hsa-miR-6852-5p PAR-CLIP 23592263
MIRT488481 hsa-miR-4667-5p PAR-CLIP 23592263
MIRT488480 hsa-miR-4700-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005783 Component Endoplasmic reticulum IDA 23453667
GO:0005789 Component Endoplasmic reticulum membrane TAS
GO:0006486 Process Protein glycosylation IMP 23453667
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610194 28596 ENSG00000162885
Protein
UniProt ID Q8NCR0
Protein name UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2 (Beta-1,3-GalNAc-T2) (EC 2.4.1.313) (Beta-1,3-N-acetylgalactosaminyltransferase II)
Protein function Beta-1,3-N-acetylgalactosaminyltransferase that synthesizes a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. Has no galactose nor galactosaminyl transferase activity toward any acceptor substrate. Involved in alpha-dy
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01762 Galactosyl_T 302 458 Galactosyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues examined, but at highest levels in testis, adipose tissue, skeletal muscle and ovary. {ECO:0000269|PubMed:14724282}.
Sequence
MRNWLVLLCPCVLGAALHLWLRLRSPPPACASGAGPADQLALFPQWKSTHYDVVVGVLSA
RNNHELRNVIRSTWMRHLLQHPTLSQRVLVKFIIGAHGCEVPVEDREDPYSCKLLNITNP
VLNQEIEAFSLSEDTSSGLPEDRVVSVSFRVLYPIVITSLGVFYDANDVGFQRNITVKLY
QAEQEEALFIARFSPPSCGVQVNKLWYKPVEQFILPESFEGTIVWESQDLHGLVSRNLHK
VTVNDGGGVLRVITAGEGALPHEFLEGVEGVAGGFIYTIQEGDALLHNLHSRPQRLIDHI
RNLHEEDALLKEESSIYDDIVFVDVVDTYRNVPAKLLNFYRWTVETTSFNLLLKTDDDCY
IDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISK
DIVKWLASNSGRLKTYQGEDVSMGIWMAAIGPKRYQDS
LWLCEKTCETGMLSSPQYSPWE
LTELWKLKERCGDPCRCQAR
Sequence length 500
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Mannose type O-glycan biosynthesis
Metabolic pathways
  O-linked glycosylation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Agenesis of corpus callosum Agenesis of corpus callosum rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Autism Autistic behavior rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Cataract Cataract rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322
View all (150 more)
Unknown
Disease term Disease name Evidence References Source
Mental depression Depressive disorder ClinVar
Specific learning disorder Specific learning disability ClinVar
Muscle Eye Brain Disease muscle-eye-brain disease GenCC
Non-Syndromic Intellectual Disability autosomal recessive non-syndromic intellectual disability GenCC
Associations from Text Mining
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 35456500
Central Nervous System Vascular Malformations Associate 24084573
Developmental Disabilities Associate 35456500
Hydrocephalus Associate 35338537
Intellectual Disability Associate 29273094
Language Development Disorders Associate 35456500
Mental Disorders Associate 29273094
Muscular Dystrophies Associate 23929950, 24084573, 25353622, 29273094, 35456500
Nonsyndromic Holoprosencephaly Associate 29273094
Seizures Associate 29273094