SLC35F3 (solute carrier family 35 member F3)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
148641
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 35 member F3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC35F3
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q42.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(15)
miRTarBase ID miRNA Experiments Reference
MIRT022707 hsa-miR-124-3p Microarray 18668037
MIRT024794 hsa-miR-215-5p Microarray 19074876
MIRT026593 hsa-miR-192-5p Microarray 19074876
MIRT1361757 hsa-miR-3652 CLIP-seq
MIRT1361758 hsa-miR-3976 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(3)
GO ID Ontology Definition Evidence Reference
GO:0015888 Process Thiamine transport IBA
GO:0015888 Process Thiamine transport IDA 24509276
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8IY50
Protein name Solute carrier family 35 member F3 (Thiamine transporter SLC35F3)
Protein function Mediates thiamine transport.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00892 EamA 67 → 223 EamA-like transporter family Family
Tissue specificity TISSUE SPECIFICITY: Expressed at the highest levels in the adult cerebellum. {ECO:0000269|PubMed:19252338}.
Sequence 
MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSR
AQLKKIFWGVAVVLCVCSSWAGSTQLAKLTFRKFDAPFTLTWFATNWNFLFFPLYYVGHV
CKSTEKQSVKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDV
SVLFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVA
SASMSALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPIILYFTKVEYWSSFDDI
PWGNLCGFSVLLLTFNIVLNFGIAVTYPTLMSLGIVLSIPVNAVIDHYTSQIVFNGVRVI
AIIIIGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARPSFA
R
Sequence length 421
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dementia Dementia N/A N/A GWAS
Insomnia Insomnia in chronic migraine N/A N/A GWAS
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Show/Hide Text Mining Associations (8)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 40302342
Colorectal Neoplasms Associate 33858496
Conversion Disorder Associate 24509276
Heart Diseases Associate 24509276
Hypertension Associate 24509276
Metabolic Syndrome Associate 36678339
Thiamine Deficiency Associate 24509276
Thyroid Cancer Papillary Associate 37733241