Gene Gene information from NCBI Gene database.
Entrez ID 148479
Gene name PHD finger protein 13
Gene symbol PHF13
Synonyms (NCBI Gene)
PHF5SPOC1
Chromosome 1
Chromosome location 1p36.31
miRNA miRNA information provided by mirtarbase database.
569
miRTarBase ID miRNA Experiments Reference
MIRT023425 hsa-miR-30b-5p Sequencing 20371350
MIRT049465 hsa-miR-92a-3p CLASH 23622248
MIRT655189 hsa-miR-5088-5p HITS-CLIP 23824327
MIRT655188 hsa-miR-26a-1-3p HITS-CLIP 23824327
MIRT655187 hsa-miR-26a-2-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0000278 Process Mitotic cell cycle IMP 19638409
GO:0003682 Function Chromatin binding IBA
GO:0003682 Function Chromatin binding IDA 19638409
GO:0005515 Function Protein binding IPI 23034801
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620054 22983 ENSG00000116273
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86YI8
Protein name PHD finger protein 13 (Survival time-associated PHD finger protein in ovarian cancer 1) (SPOC1)
Protein function Modulates chromatin structure and DNA damage response by regulating key determinants of chromatin compaction and DNA damage response (PubMed:19638409). Binds H3K4me3-containing chromatin and promotes DNA condensation by recruiting corepressors s
PDB 3O70 , 3O7A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00628 PHD 234 280 PHD-finger Domain
Sequence
MDSDSCAAAFHPEEYSPSCKRRRTVEDFNKFCTFVLAYAGYIPYPKEELPLRSSPSPANS
TAGTIDSDGWDAGFSDIASSVPLPVSDRCFSHLQPTLLQRAKPSNFLLDRKKTDKLKKKK
KRKRRDSDAPGKEGYRGGLLKLEAADPYVETPTSPTLQDIPQAPSDPCSGWDSDTPSSGS
CATVSPDQVKEIKTEGKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKP
FAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDS
KFDIRRSNRSRTGSRKLFLD
Sequence length 300
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hepatocellular carcinoma Benign rs116799550 RCV005904786
Uterine corpus endometrial carcinoma Benign rs116799550 RCV005904787
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Lupus Erythematosus Systemic Associate 37841281
Neoplasm Metastasis Associate 35597793
Neoplasms Associate 35597793
Neoplasms Radiation Induced Associate 23034801
Pancreatic Neoplasms Associate 35597793