Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Other IDs Protein Associated diseases
Entrez ID	148418
Gene name	Sterile alpha motif domain containing 13
Gene symbol	SAMD13
Synonyms (NCBI Gene)	DJLHSD-41HSD-42
Chromosome	1
Chromosome location	1p31.1

Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026757	hsa-miR-192-5p	Microarray	19074876
MIRT1325150	hsa-miR-3163	CLIP-seq
MIRT1325151	hsa-miR-3686	CLIP-seq
MIRT1325152	hsa-miR-3923	CLIP-seq
MIRT1325153	hsa-miR-4778-5p	CLIP-seq
MIRT1325154	hsa-miR-548c-3p	CLIP-seq
MIRT1325155	hsa-miR-628-3p	CLIP-seq
MIRT1325156	hsa-miR-802	CLIP-seq
MIRT2096487	hsa-miR-514	CLIP-seq
MIRT2096488	hsa-miR-514b-3p	CLIP-seq
MIRT2320921	hsa-miR-4756-3p	CLIP-seq
MIRT2320922	hsa-miR-642b	CLIP-seq
MIRT2394008	hsa-miR-4268	CLIP-seq
MIRT2394009	hsa-miR-4448	CLIP-seq

MIM	HGNC	e!Ensembl
620800	24582	ENSG00000203943

Q5VXD3

Protein name

Sterile alpha motif domain-containing protein 13 (SAM domain-containing protein 13)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00536	SAM_1	49 → 109	SAM domain (Sterile alpha motif)	Domain

Sequence

MANSLLEGVFAEVKEPCSLPMLSVDMENKENGSVGVKNSMENGRPPDPADWAVMDVVNYF
RTVGFEEQASAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNN
SS

Sequence length

122

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Stimulate	37968735	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Associate	30651076	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	37968735	★★★★★ ★☆☆☆☆ Found in Text Mining only

SAMD13 (sterile alpha motif domain containing 13)