Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	148281
Gene name	Synaptotagmin 6
Gene symbol	SYT6
Synonyms (NCBI Gene)	sytVI
Chromosome	1
Chromosome location	1p13.2
Summary	The protein encoded by this gene belongs to the synaptotagmin family. Synaptotagmins share a common domain structure that includes a transmembrane domain and a cytoplasmic region composed of 2 C2 domains, and are involved in calcium-dependent exocytosis o

Show/Hide all (72)

miRTarBase ID	miRNA	Experiments	Reference
MIRT617035	hsa-miR-634	HITS-CLIP	23824327
MIRT617034	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT617033	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT617032	hsa-miR-623	HITS-CLIP	23824327
MIRT617031	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT617030	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT617029	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT617028	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT617027	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT617026	hsa-miR-3685	HITS-CLIP	23824327
MIRT617025	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT617035	hsa-miR-634	HITS-CLIP	23824327
MIRT617034	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT617033	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT617032	hsa-miR-623	HITS-CLIP	23824327
MIRT617031	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT617030	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT617029	hsa-miR-155-3p	HITS-CLIP	23824327
MIRT617028	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT617027	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT617026	hsa-miR-3685	HITS-CLIP	23824327
MIRT617025	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT1407676	hsa-miR-1208	CLIP-seq
MIRT1407677	hsa-miR-1294	CLIP-seq
MIRT1407678	hsa-miR-204	CLIP-seq
MIRT1407679	hsa-miR-2054	CLIP-seq
MIRT1407680	hsa-miR-211	CLIP-seq
MIRT1407681	hsa-miR-2116	CLIP-seq
MIRT1407682	hsa-miR-3121-5p	CLIP-seq
MIRT1407683	hsa-miR-3692	CLIP-seq
MIRT1407684	hsa-miR-4252	CLIP-seq
MIRT1407685	hsa-miR-4316	CLIP-seq
MIRT1407686	hsa-miR-4436a	CLIP-seq
MIRT1407687	hsa-miR-4436b-5p	CLIP-seq
MIRT1407688	hsa-miR-4632	CLIP-seq
MIRT1407689	hsa-miR-4659a-3p	CLIP-seq
MIRT1407690	hsa-miR-4659b-3p	CLIP-seq
MIRT1407691	hsa-miR-4677-3p	CLIP-seq
MIRT1407692	hsa-miR-4677-5p	CLIP-seq
MIRT1407693	hsa-miR-4679	CLIP-seq
MIRT1407694	hsa-miR-4778-3p	CLIP-seq
MIRT1407695	hsa-miR-526b	CLIP-seq
MIRT1407696	hsa-miR-579	CLIP-seq
MIRT1407697	hsa-miR-942	CLIP-seq
MIRT2122156	hsa-miR-4722-3p	CLIP-seq
MIRT2122157	hsa-miR-548g	CLIP-seq
MIRT2122158	hsa-miR-607	CLIP-seq
MIRT2344478	hsa-miR-1245b-5p	CLIP-seq
MIRT2344479	hsa-miR-1261	CLIP-seq
MIRT1407677	hsa-miR-1294	CLIP-seq
MIRT2344480	hsa-miR-2114	CLIP-seq
MIRT2344481	hsa-miR-22	CLIP-seq
MIRT2344482	hsa-miR-3126-5p	CLIP-seq
MIRT2344483	hsa-miR-3142	CLIP-seq
MIRT2344484	hsa-miR-3201	CLIP-seq
MIRT2344485	hsa-miR-3922-5p	CLIP-seq
MIRT2344486	hsa-miR-3941	CLIP-seq
MIRT2344487	hsa-miR-4291	CLIP-seq
MIRT2344488	hsa-miR-4310	CLIP-seq
MIRT1407685	hsa-miR-4316	CLIP-seq
MIRT2344489	hsa-miR-4419a	CLIP-seq
MIRT2344490	hsa-miR-4420	CLIP-seq
MIRT2344491	hsa-miR-4510	CLIP-seq
MIRT2344492	hsa-miR-4643	CLIP-seq
MIRT2344493	hsa-miR-466	CLIP-seq
MIRT2344494	hsa-miR-4672	CLIP-seq
MIRT1407691	hsa-miR-4677-3p	CLIP-seq
MIRT1407693	hsa-miR-4679	CLIP-seq
MIRT2344495	hsa-miR-4708-3p	CLIP-seq
MIRT2344496	hsa-miR-4789-3p	CLIP-seq
MIRT2344497	hsa-miR-4791	CLIP-seq
MIRT1407697	hsa-miR-942	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000149	Function	SNARE binding	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	7791877
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016192	Process	Vesicle-mediated transport	IBA
GO:0017158	Process	Regulation of calcium ion-dependent exocytosis	IBA
GO:0019905	Function	Syntaxin binding	IDA	7791877
GO:0030276	Function	Clathrin binding	IDA	7791877
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060478	Process	Acrosomal vesicle exocytosis	IMP	11437455
GO:0061891	Function	Calcium ion sensor activity	IBA
GO:0070382	Component	Exocytic vesicle	IBA
GO:0097038	Component	Perinuclear endoplasmic reticulum	ISS

MIM	HGNC	e!Ensembl
607718	18638	ENSG00000134207

Q5T7P8

Protein name

Synaptotagmin-6 (Synaptotagmin VI) (SytVI)

Protein function

May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. May mediate Ca(2+)-regulation of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	244 → 352	C2 domain	Domain
PF00168	C2	376 → 493	C2 domain	Domain

Sequence

MSGVWGAGGPRCQEALAVLASLCRARPPPLGLDVETCRSFELQPPERSPSAAGAGTSVSL
LAVVVIVCGVALVAVFLFLFWKLCWMPWRNKEASSPSSANPPLEALQSPSFRGNMADKLK
DPSTLGFLEAAVKISHTSPDIPAEVQMSVKEHIMRHTRLQRQTTEPASSTRHTSFKRHLP
RQMHVSSVDYGNELPPAAEQPTSIGRIKPELYKQKSVDGEDAKSEATKSCGKINFSLRYD
YETETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHF
PVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWKDIQYATSESV
DLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIK
KNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGITAEGLGRDHWN
EMLAYPRKPIAHWHSLVEVKKSFKEGNPRL

Sequence length

510

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast ductal adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

SYT6 (synaptotagmin 6)