Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	148266
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger protein 569
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZNF569
Synonyms (NCBI Gene) Gene synonyms aliases	ZAP1, ZNF, Zfp74
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.12

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments
MIRT1530178	hsa-miR-1245	CLIP-seq
MIRT1530179	hsa-miR-1299	CLIP-seq
MIRT1530180	hsa-miR-3168	CLIP-seq
MIRT1530181	hsa-miR-3177-5p	CLIP-seq
MIRT1530182	hsa-miR-3664-5p	CLIP-seq
MIRT1530183	hsa-miR-3675-3p	CLIP-seq
MIRT1530184	hsa-miR-4265	CLIP-seq
MIRT1530185	hsa-miR-4296	CLIP-seq
MIRT1530186	hsa-miR-4322	CLIP-seq
MIRT1530187	hsa-miR-4714-5p	CLIP-seq
MIRT1530188	hsa-miR-4753-3p	CLIP-seq
MIRT1530189	hsa-miR-599	CLIP-seq
MIRT1530190	hsa-miR-875-3p	CLIP-seq
MIRT2160291	hsa-miR-3200-3p	CLIP-seq
MIRT2379613	hsa-miR-125a-3p	CLIP-seq
MIRT2379614	hsa-miR-1305	CLIP-seq
MIRT2379615	hsa-miR-2113	CLIP-seq
MIRT2379616	hsa-miR-2116	CLIP-seq
MIRT2379617	hsa-miR-3686	CLIP-seq
MIRT2379618	hsa-miR-3934	CLIP-seq
MIRT2379619	hsa-miR-3942-3p	CLIP-seq
MIRT2379620	hsa-miR-421	CLIP-seq
MIRT2379621	hsa-miR-4677-5p	CLIP-seq
MIRT2379622	hsa-miR-4742-3p	CLIP-seq
MIRT2379623	hsa-miR-4778-5p	CLIP-seq
MIRT2379624	hsa-miR-550a	CLIP-seq
MIRT2379625	hsa-miR-764	CLIP-seq
MIRT2379615	hsa-miR-2113	CLIP-seq
MIRT2441853	hsa-miR-3121-5p	CLIP-seq
MIRT2441854	hsa-miR-4318	CLIP-seq
MIRT2441855	hsa-miR-4326	CLIP-seq
MIRT2441856	hsa-miR-4693-5p	CLIP-seq
MIRT2441857	hsa-miR-892a	CLIP-seq
MIRT2671612	hsa-miR-409-3p	CLIP-seq
MIRT2671613	hsa-miR-4684-5p	CLIP-seq
MIRT2671614	hsa-miR-7	CLIP-seq
MIRT2671612	hsa-miR-409-3p	CLIP-seq
MIRT2671613	hsa-miR-4684-5p	CLIP-seq
MIRT2671614	hsa-miR-7	CLIP-seq

Show/Hide all(6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
613904	24737	ENSG00000196437

Protein

UniProt ID

Q5MCW4

Protein name

Zinc finger protein 569

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	7 → 48	KRAB box	Family
PF00096	zf-C2H2	186 → 208	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	214 → 236	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	242 → 264	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	270 → 292	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	298 → 320	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	326 → 348	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	354 → 376	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	382 → 404	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	410 → 432	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	438 → 460	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	466 → 488	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	494 → 516	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	522 → 544	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	550 → 572	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	578 → 600	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	606 → 628	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	634 → 656	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	662 → 684	Zinc finger, C2H2 type	Domain

Sequence

MTESQGTVTFKDVAIDFTQEEWKRLDPAQRKLYRNVMLENYNNLITVGYPFTKPDVIFKL
EQEEEPWVMEEEVLRRHWQGEIWGVDEHQKNQDRLLRQVEVKFQKTLTEEKGNECQKKFA
NVFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNVKCLMRKEHCEYNEPVKSYGNSSSH
FVITPFKCNHCGKGFNQTLDLIRHLRIHTGEKPYECSNCRKAFSHKEKLIKHYKIHSREQ
SYKCNECGKAFIKMSNLIRHQRIHTGEKPYACKECEKSFSQKSNLIDHEKIHTGEKPYEC
NECGKAFSQKQSLIAHQKVHTGEKPYACNECGKAFPRIASLALHMRSHTGEKPYKCDKCG
KAFSQFSMLIIHVRIHTGEKPYECNECGKAFSQSSALTVHMRSHTGEKPYECKECRKAFS
HKKNFITHQKIHTREKPYECNECGKAFIQMSNLVRHQRIHTGEKPYICKECGKAFSQKSN
LIAHEKIHSGEKPYECNECGKAFSQKQNFITHQKVHTGEKPYDCNECGKAFSQIASLTLH
LRSHTGEKPYECDKCGKAFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRGH
TGEKPYECNKCGKAFSQSSSLTIHIRGHTGEKPFDCSKCGKAFSQISSLTLHMRKHTGEK
PYHCIECGKAFSQKSHLVRHQRIHTH

Sequence length

686

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)	21278247
Colorectal neoplasms	Colorectal Neoplasms	rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049 View all (1682 more)	21278247

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Barrett Esophagus	Associate	29084829
Esophageal Neoplasms	Associate	36670548
Stomach Neoplasms	Associate	29844130

ZNF569 (zinc finger protein 569)