ZNF599 (zinc finger protein 599)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 148103
Gene name Zinc finger protein 599
Gene symbol ZNF599
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.11
miRNA miRNA information provided by mirtarbase database.
9
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (9)
miRTarBase ID miRNA Experiments Reference
MIRT1531389 hsa-miR-1200 CLIP-seq
MIRT1531390 hsa-miR-382 CLIP-seq
MIRT1531391 hsa-miR-4326 CLIP-seq
MIRT2160630 hsa-miR-217 CLIP-seq
MIRT2160631 hsa-miR-4420 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96NL3
Protein name Zinc finger protein 599
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 8 → 49 KRAB box Family
PF00096 zf-C2H2 199 → 221 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 227 → 249 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 255 → 277 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 283 → 305 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 311 → 333 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 339 → 361 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 367 → 389 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 395 → 417 Zinc finger, C2H2 type Domain
PF13465 zf-H2C2_2 437 → 462 Domain
PF00096 zf-C2H2 479 → 501 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 507 → 529 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 535 → 557 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 563 → 585 Zinc finger, C2H2 type Domain
Sequence 
MAAPALALVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETCRLLVSLGHPVPKPELIYL
LEHGQELWTVKRGLSQSTCAGEKAKPKITEPTASQLAFSEESSFQELLAQRSSRDSRLGQ
ARDEEKLIKIQEGNLRPGTNPHKEICPEKLSYKHDDLEPDDSLGLRVLQERVTPQDALHE
CDSQGPGKDPMTDARNNPYTCTECGKGFSKKWALVRHQQIHAGVKPYECNECGKACRYMA
DVIRHMRLHTGEKPYKCIECGKAFKRRFHLTEHQRIHTGDKPYECKECGKAFTHRSSFIQ
HNMTHTREKPFLCKECGKAFYYSSSFAQHMRIHTGKKLYECGECGKAFTHRSTFIQHNVT
HTGEKPFLCKECGKTFCLNSSFTQHMRIHTGEKPYECGECGKAFTHRSTFIRHKRTHTGE
KPFECKECGKAFCDSSSLIQHMRIHTGEKPYECSECGKAFTHHSVFIRHNRTHSGQKPLE
CKECAKAFYYSSSFTRHMRIHTGEKPYVCRECGKAFTQPANFVRHNRIHTGEKPFECKEC
EKAFCDNFALTQHMRTHTGEKPFECNECGKTFSHSSSFTHHRKIHTRV
Sequence length 588
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  Reactome
    Generic Transcription Pathway