Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
148022
Gene name Gene Name - the full gene name approved by the HGNC.
TIR domain containing adaptor molecule 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TICAM1
Synonyms (NCBI Gene) Gene synonyms aliases
IIAE6, MyD88-3, PRVTIRB, TICAM-1, TRIF
Disease Acronyms (UniProt) Disease acronyms from UniProt database
IIAE6
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an adaptor protein containing a Toll/interleukin-1 receptor (TIR) homology domain, which is an intracellular signaling domain that mediates protein-protein interactions between the Toll-like receptors (TLRs) and signal-transduction compo
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs143679494 C>A,T Likely-benign, risk-factor Missense variant, coding sequence variant
rs387907307 G>A,C Risk-factor Stop gained, coding sequence variant, missense variant
rs1555730283 G>A Risk-factor Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005475 hsa-miR-221-3p Luciferase reporter assay, Northern blot, qRT-PCR, Western blot 21236259
MIRT041391 hsa-miR-193b-3p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
SP1 Repression 14960149
TRAF6 Unknown 14530355;20047764
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002281 Process Macrophage activation involved in immune response IEA
GO:0002735 Process Positive regulation of myeloid dendritic cell cytokine production IBA 21873635
GO:0002735 Process Positive regulation of myeloid dendritic cell cytokine production ISS
GO:0002756 Process MyD88-independent toll-like receptor signaling pathway TAS
GO:0005515 Function Protein binding IPI 14982987, 15142865, 15841462, 19416887, 21903422, 22948160, 25736436
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607601 18348 ENSG00000127666
Protein
UniProt ID Q8IUC6
Protein name TIR domain-containing adapter molecule 1 (TICAM-1) (Proline-rich, vinculin and TIR domain-containing protein B) (Putative NF-kappa-B-activating protein 502H) (Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta) (MyD88-3
Protein function Involved in innate immunity against invading pathogens. Adapter used by TLR3, TLR4 (through TICAM2) and TLR5 to mediate NF-kappa-B and interferon-regulatory factor (IRF) activation, and to induce apoptosis (PubMed:12471095, PubMed:12539043, PubM
PDB 2M1X , 2M63 , 3RC4 , 4BSX , 4C0M , 5JEL , 9DK8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17798 TRIF-NTD 1 148 TRIF N-terminal domain Domain
PF12721 RHIM 642 697 RIP homotypic interaction motif Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed but with higher levels in liver. {ECO:0000269|PubMed:12471095, ECO:0000269|PubMed:12539043}.
Sequence
MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARIS
LEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQE
AVRTLSSRDDHRLGELQDEARNRCGWDI
AGDPGSIRTLQSNLGCLPPSSALPSGTRSLPR
PIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLSLHRSPHGPSKLCDDPQASLVP
EPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAPDATSTGLPDTPAAPETSTNY
PVECTEGSAGPQSLPLPILEPVKNPCSVKDQTPLQLSVEDTTSPNTKPCPPTPTTPETSP
PPPPPPPSSTPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEALG
VPDGATFCEDFQVPGRGELSCLQDAIDHSAFIILLLTSNFDCRLSLHQVNQAMMSNLTRQ
GSPDCVIPFLPLESSPAQLSSDTASLLSGLVRLDEHSQIFARKVANTFKPHRLQARKAMW
RKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTG
APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQS
PAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWN
QRGSQAPEDKTQEAE
Sequence length 712
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  NF-kappa B signaling pathway
Necroptosis
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Alcoholic liver disease
Pertussis
Yersinia infection
Chagas disease
Hepatitis C
Hepatitis B
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis
  Caspase activation via Death Receptors in the presence of ligand
MyD88-independent TLR4 cascade
Toll Like Receptor 3 (TLR3) Cascade
TICAM1, RIP1-mediated IKK complex recruitment
RIP-mediated NFkB activation via ZBP1
TRIF-mediated programmed cell death
TICAM1 deficiency - HSE
TRAF3 deficiency - HSE
TLR3-mediated TICAM1-dependent programmed cell death
TICAM1-dependent activation of IRF3/IRF7
TICAM1,TRAF6-dependent induction of TAK1 complex
Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
IKK complex recruitment mediated by RIP1
TRAF6-mediated induction of TAK1 complex within TLR4 complex
IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Unknown
Disease term Disease name Evidence References Source
Encephalitis herpes simplex encephalitis, susceptibility to, 4 GenCC
Vitiligo Vitiligo GWAS
Hypothyroidism Hypothyroidism GWAS
Carcinoma Carcinoma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 37168851
Breast Neoplasms Associate 31287789
Carcinoma Basal Cell Associate 34278484
Carcinoma Squamous Cell Associate 22808251
Colorectal Neoplasms Associate 34689394
Diabetes Mellitus Type 2 Associate 20067962
Down Syndrome Associate 31611734
Encephalitis Stimulate 29116594
Encephalitis Herpes Simplex Associate 22105173
Esophageal Neoplasms Associate 36588538