DACT3 (dishevelled binding antagonist of beta catenin 3)

Gene

• Entrez ID: 147906
• Gene name: Dishevelled binding antagonist of beta catenin 3
• Gene symbol: DACT3
• Synonyms (NCBI Gene): DAPPER3, RRR1
• Chromosome: 19
• Chromosome location: 19q13.32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005875	hsa-miR-31-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21048943
MIRT005875	hsa-miR-31-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21048943
MIRT005875	hsa-miR-31-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21048943
MIRT005875	hsa-miR-31-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21048943
MIRT005875	hsa-miR-31-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21048943
MIRT731470	hsa-miR-638	Luciferase reporter assay, qRT-PCR, Western blot	28108314
MIRT731470	hsa-miR-638	Luciferase reporter assay, qRT-PCR, Western blot	28108314
MIRT731470	hsa-miR-638	Luciferase reporter assay, qRT-PCR, Western blot	28108314
MIRT731470	hsa-miR-638	Luciferase reporter assay, qRT-PCR, Western blot	28108314
MIRT756101	hsa-miR-9-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35598381
MIRT922683	hsa-miR-101	CLIP-seq
MIRT922684	hsa-miR-1183	CLIP-seq
MIRT922685	hsa-miR-1245b-3p	CLIP-seq
MIRT922686	hsa-miR-144	CLIP-seq
MIRT922687	hsa-miR-3121-5p	CLIP-seq
MIRT922688	hsa-miR-3126-3p	CLIP-seq
MIRT922689	hsa-miR-3150a-3p	CLIP-seq
MIRT922690	hsa-miR-3175	CLIP-seq
MIRT922691	hsa-miR-3176	CLIP-seq
MIRT922692	hsa-miR-3609	CLIP-seq
MIRT922693	hsa-miR-3915	CLIP-seq
MIRT922694	hsa-miR-3922-3p	CLIP-seq
MIRT922695	hsa-miR-3928	CLIP-seq
MIRT922696	hsa-miR-4667-5p	CLIP-seq
MIRT922697	hsa-miR-4700-5p	CLIP-seq
MIRT922698	hsa-miR-4775	CLIP-seq
MIRT922699	hsa-miR-4799-5p	CLIP-seq
MIRT922700	hsa-miR-495	CLIP-seq
MIRT922701	hsa-miR-548ah	CLIP-seq
MIRT922702	hsa-miR-590-3p	CLIP-seq
MIRT922703	hsa-miR-645	CLIP-seq
MIRT922704	hsa-miR-939	CLIP-seq
MIRT1973323	hsa-miR-1184	CLIP-seq
MIRT1973324	hsa-miR-1205	CLIP-seq
MIRT1973325	hsa-miR-1909	CLIP-seq
MIRT1973326	hsa-miR-3158-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EZH2	Repression	22144423
NKX2-5	Repression	19479054

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005080	Function	Protein kinase C binding	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	18538736
GO:0030308	Process	Negative regulation of cell growth	IDA	18538736
GO:0042802	Function	Identical protein binding	IEA
GO:0051018	Function	Protein kinase A binding	IEA
GO:0051018	Function	Protein kinase A binding	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0070097	Function	Delta-catenin binding	IEA
GO:0070097	Function	Delta-catenin binding	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	18538736
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA

Other IDs

• MIM: 611112
• HGNC: 30745
• e!Ensembl: ENSG00000197380

Protein

• UniProt ID: Q96B18
• Protein name: Dapper homolog 3 (Antagonist of beta-catenin Dapper homolog 3) (Arginine-rich region 1 protein) (Dapper antagonist of catenin 3)
• Protein function: May be involved in regulation of intracellular signaling pathways during development. Specifically thought to play a role in canonical and/or non-canonical Wnt signaling pathways through interaction with DSH (Dishevelled) family proteins. {ECO:0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15268	Dapper	19 → 166	Dapper	Family
  PF15268	Dapper	543 → 629	Dapper	Family

• Sequence:

  MIRAFSFPVSPERGRLRGWLEGSLAGLCELHWLRERQEYRVQQALRLAQPGMGGAEAEDE
  EDADEDEDAAAARRAAAALEEQLEALPGLVWDLGQQLGDLSLESGGLEQESGRSSGFYED
  PSSTGGPDSPPSTFCGDSGFSGSSSYGRLGPSEPRGIYASERPKSLGDASPSAPEVVGAR
  AAVPRSFSAPYPTAGGSAGPEACSSAERRARAGPFLTPSPLHAVAMRSPRPCGRPPTDSP
  DAGGAGRPLDGYISALLRRRRRRGAGQPRTSPGGADGGPRRQNSVRQRPPDASPSPGSAR
  PAREPSLERVGGHPTSPAALSRAWASSWESEAAPEPAAPPAAPSPPDSPAEGRLVKAQYI
  PGAQAATRGLPGRAARRKPPPLTRGRSVEQSPPRERPRAAGRRGRMAEASGRRGSPRARK
  ASRSQSETSLLGRASAVPSGPPKYPTAEREEPRPPRPRRGPAPTLAAQAAGSCRRWRSTA
  EIDAADGRRVRPRAPAARVPGPGPSPSAPQRRLLYGCAGSDSECSAGRLGPLGRRGPAGG
  VGGGYGESESSASEGESPAFSSASSDSDGSGGLVWPQQLVAATAASGGGAGAGAPAGPAK
  VFVKIKASHALKKKILRFRSGSLKVMTTV

• Sequence length: 629

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Intellectual disability	Uncertain significance	rs1004016023	RCV000758001
Progressive spastic paraparesis	Uncertain significance	rs1004016023	RCV000758001

Associations from Text Mining
Disease Name	Relationship Type	References
Carcinoma Hepatocellular	Associate	35764883
Colorectal Neoplasms	Associate	18538736
Esophageal Neoplasms	Inhibit	28077137
Hypoxia	Stimulate	35764883
Inflammation	Associate	39341975
Leukemia Lymphocytic Chronic B Cell	Associate	22235315
Lung Neoplasms	Associate	21048943
Neoplasm Metastasis	Associate	35764883
Thyroid Cancer Papillary	Associate	21642358
Varicose Veins	Associate	39341975