TMC4 (transmembrane channel like 4)

Gene

• Entrez ID: 147798
• Gene name: Transmembrane channel like 4
• Gene symbol: TMC4
• Synonyms (NCBI Gene): -
• Chromosome: 19
• Chromosome location: 19q13.42

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1428014	hsa-miR-3150a-5p	CLIP-seq
MIRT1428015	hsa-miR-3150b-5p	CLIP-seq
MIRT1428016	hsa-miR-330-3p	CLIP-seq
MIRT1428017	hsa-miR-4638-5p	CLIP-seq
MIRT1428018	hsa-miR-518a-3p	CLIP-seq
MIRT1428019	hsa-miR-518b	CLIP-seq
MIRT1428020	hsa-miR-518c	CLIP-seq
MIRT1428021	hsa-miR-518d-3p	CLIP-seq
MIRT1428022	hsa-miR-518f	CLIP-seq
MIRT1428023	hsa-miR-545	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005247	Function	Voltage-gated chloride channel activity	IDA	34468713
GO:0005247	Function	Voltage-gated chloride channel activity	IMP	34429071
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0008381	Function	Mechanosensitive monoatomic ion channel activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1902476	Process	Chloride transmembrane transport	IEA

Other IDs

• MIM: 617181
• HGNC: 22998
• e!Ensembl: ENSG00000167608

Protein

• UniProt ID: Q7Z404
• Protein name: Voltage-gated chloride channel TMC4 (Transmembrane channel-like protein 4)
• Protein function: Voltage-gated chloride channel involved in high-concentration salt taste sensation (PubMed:34429071, PubMed:34468713). Depolarization induced by high NaCl concentration may trigger the activation of TMC4-mediated chloride influx into taste bud c
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07810	TMC	475 → 585	TMC domain	Domain

• Sequence:

  MEENPTLESEAWGSSRGWLAPREARGAPCSSPGPSLSSVLNELPSAATLRYRDPGVLPWG
  ALEEEEEDGGRSRKAFTEVTQTELQDPHPSRELPWPMQARRAHRQRNASRDQVVYGSGTK
  TDRWARLLRRSKEKTKEGLRSLQPWAWTLKRIGGQFGAGTESYFSLLRFLLLLNVLASVL
  MACMTLLPTWLGGAPPGPPGPDISSPCGSYNPHSQGLVTFATQLFNLLSGEGYLEWSPLF
  YGFYPPRPRLAVTYLCWAFAVGLICLLLILHRSVSGLKQTLLAESEALTSYSHRVFSAWD
  FGLCGDVHVRLRQRIILYELKVELEETVVRRQAAVRTLGQQARVWLVRVLLNLLVVALLG
  AAFYGVYWATGCTVELQEMPLVQELPLLKLGVNYLPSIFIAGVNFVLPPVFKLIAPLEGY
  TRSRQIVFILLRTVFLRLASLVVLLFSLWNQITCGGDSEAEDCKTCGYNYKQLPCWETVL
  GQEMYKLLLFDLLTVLAVALLIQFPRKLLCGLCPGALGRLAGTQEFQVPDEVLGLIYAQT
  VVWVGSFFCPLLPLLNTVKFLLLFYLKKLTLFSTCSPAARTFRASAANFFFPLVLLLGLA
  ISSVPLLYSIFLIPPSKLCGPFRGQSSIWAQIPESISSLPETTQNFLFFLGTQAFAVPLL
  LISSILMAYTVALANSYGRLISELKRQRQTEAQNKVFLARRAVALTSTKPAL

• Sequence length: 712

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TMC4-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Alcoholism	Associate	26850495	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	28674415	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	37468683	★☆☆☆☆ Found in Text Mining only
Chemical and Drug Induced Liver Injury	Associate	26850495	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Associate	35620859	★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	26850495	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Associate	36371078	★☆☆☆☆ Found in Text Mining only
Non alcoholic Fatty Liver Disease	Associate	26850495, 28674415, 29385134, 34823063	★☆☆☆☆ Found in Text Mining only
Plaque Amyloid	Associate	27743375	★☆☆☆☆ Found in Text Mining only