ANKRD29 (ankyrin repeat domain 29)

Gene

• Entrez ID: 147463
• Gene name: Ankyrin repeat domain 29
• Gene symbol: ANKRD29
• Synonyms (NCBI Gene): -
• Chromosome: 18
• Chromosome location: 18q11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002779	hsa-miR-1-3p	Microarray	15685193
MIRT018603	hsa-miR-335-5p	Microarray	18185580
MIRT019593	hsa-miR-340-5p	Sequencing	20371350
MIRT020251	hsa-miR-130b-3p	Sequencing	20371350
MIRT021843	hsa-miR-132-3p	Microarray	17612493
MIRT002779	hsa-miR-1-3p	Microarray;Other	15685193
MIRT028125	hsa-miR-93-5p	Sequencing	20371350
MIRT028228	hsa-miR-33a-5p	Sequencing	20371350
MIRT783457	hsa-miR-1183	CLIP-seq
MIRT783458	hsa-miR-125a-5p	CLIP-seq
MIRT783459	hsa-miR-125b	CLIP-seq
MIRT783460	hsa-miR-153	CLIP-seq
MIRT783461	hsa-miR-23a	CLIP-seq
MIRT783462	hsa-miR-23b	CLIP-seq
MIRT783463	hsa-miR-23c	CLIP-seq
MIRT783464	hsa-miR-297	CLIP-seq
MIRT783465	hsa-miR-3074-3p	CLIP-seq
MIRT783466	hsa-miR-31	CLIP-seq
MIRT783467	hsa-miR-3125	CLIP-seq
MIRT783468	hsa-miR-3132	CLIP-seq
MIRT783469	hsa-miR-3150b-3p	CLIP-seq
MIRT783470	hsa-miR-3160-3p	CLIP-seq
MIRT783471	hsa-miR-3916	CLIP-seq
MIRT783472	hsa-miR-4307	CLIP-seq
MIRT783473	hsa-miR-4319	CLIP-seq
MIRT783474	hsa-miR-4427	CLIP-seq
MIRT783475	hsa-miR-4451	CLIP-seq
MIRT783476	hsa-miR-448	CLIP-seq
MIRT783477	hsa-miR-4487	CLIP-seq
MIRT783478	hsa-miR-4680-3p	CLIP-seq
MIRT783479	hsa-miR-4732-3p	CLIP-seq
MIRT783480	hsa-miR-4762-3p	CLIP-seq
MIRT783481	hsa-miR-4784	CLIP-seq
MIRT783482	hsa-miR-558	CLIP-seq
MIRT783483	hsa-miR-567	CLIP-seq
MIRT783484	hsa-miR-670	CLIP-seq
MIRT783485	hsa-miR-877	CLIP-seq
MIRT1931112	hsa-miR-203	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q8N6D5
• Protein name: Ankyrin repeat domain-containing protein 29
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12796	Ank_2	5 → 76	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	75 → 142	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	134 → 207	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	182 → 273	Ankyrin repeats (3 copies)	Repeat

• Sequence:

  MCRMSFKKETPLANAAFWAARRGNLALLKLLLNSGRVDVDCRDSHGTTLLMVAAYAGHID
  CVRELVLQGADINLQRESGTTALFFAAQQGHNDVVRFLFGFGASTEFRTKDGGTALLAAS
  QYGHMQVVETLLKHGANIHDQLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPRQDGTA
  PLWIASQMGHSEVVRVMLLRGADRDAARNDGTTALLKAANKGYNDVIKELLKFSPTLGIL
  KNGTSALHAAVLSGNIKTVALLLEAGADPSLRNKANELPAELTKNERILRLLRSKEGPRK
  S

• Sequence length: 301

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243

Associations from Text Mining
Disease Name	Relationship Type	References
Carcinoma Non Small Cell Lung	Associate	37277814
Epilepsy	Associate	37192718
Glioma	Associate	37192718