Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	147381
Gene name Gene Name - the full gene name approved by the HGNC.	Cerebellin 2 precursor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CBLN2
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18q22.3

Show/Hide all(43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT638915	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT638914	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT638913	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT638912	hsa-miR-105-3p	HITS-CLIP	23824327
MIRT638911	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT638910	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT638915	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT638914	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT638913	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT638912	hsa-miR-105-3p	HITS-CLIP	23824327
MIRT638911	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT638910	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT638915	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT638914	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT638913	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT638912	hsa-miR-105-3p	HITS-CLIP	23824327
MIRT638911	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT638910	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT638915	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT638914	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT638913	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT638912	hsa-miR-105-3p	HITS-CLIP	23824327
MIRT638911	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT638910	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT865670	hsa-miR-2116	CLIP-seq
MIRT865671	hsa-miR-3189-3p	CLIP-seq
MIRT865672	hsa-miR-3606	CLIP-seq
MIRT865673	hsa-miR-4320	CLIP-seq
MIRT865674	hsa-miR-450b-3p	CLIP-seq
MIRT865675	hsa-miR-4642	CLIP-seq
MIRT865676	hsa-miR-4643	CLIP-seq
MIRT865677	hsa-miR-4733-3p	CLIP-seq
MIRT865678	hsa-miR-502-5p	CLIP-seq
MIRT865679	hsa-miR-769-3p	CLIP-seq
MIRT865680	hsa-miR-921	CLIP-seq
MIRT1956737	hsa-miR-1284	CLIP-seq
MIRT2194007	hsa-miR-2115	CLIP-seq
MIRT2194008	hsa-miR-224	CLIP-seq
MIRT2194009	hsa-miR-3919	CLIP-seq
MIRT2194010	hsa-miR-4705	CLIP-seq
MIRT2194011	hsa-miR-513a-5p	CLIP-seq
MIRT2194012	hsa-miR-526b	CLIP-seq
MIRT2194013	hsa-miR-885-5p	CLIP-seq

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence
GO:0005615	Component	Extracellular space	IEA
GO:0050808	Process	Synapse organization	ISS
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0098814	Process	Spontaneous synaptic transmission	ISS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099558	Process	Maintenance of synapse structure	ISS
GO:1905606	Process	Regulation of presynapse assembly	IEA

MIM	HGNC	e!Ensembl
600433	1544	ENSG00000141668

Protein

UniProt ID

Q8IUK8

Protein name

Cerebellin-2

Protein function

Acts as a synaptic organizer in specific subsets of neurons in the brain. Essential for long-term maintenance but not establishment of excitatory synapses. Functions as part of a trans-synaptic complex by binding to postsynaptic GRID1 and presyn

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00386	C1q	94 → 221	C1q domain	Domain

Sequence

MQAPGRGPLGLRLMMPGRRGALREPGGCGSCLGVALALLLLLLPACCPVRAQNDTEPIVL
EGKCLVVCDSSPSADGAVTSSLGISVRSGSAKVAFSATRSTNHEPSEMSNRTMTIYFDQV
LVNIGNHFDLASSIFVAPRKGIYSFSFHVVKVYNRQTIQVSLMQNGYPVISAFAGDQDVT
REAASNGVLLLMEREDKVHLKLERGNLMGGWKYSTFSGFLVFPL

Sequence length

224

Interactions

View interactions

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Colonic neoplasms	Malignant tumor of colon	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	29228715
Colorectal cancer	Colorectal Carcinoma, Adenocarcinoma of large intestine	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)	29228715
Colorectal neoplasms	Colorectal Neoplasms, Malignant neoplasm of large intestine	rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049 View all (1682 more)	29228715
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	30621171

Show/Hide Unknown Diseases (8)

Disease term	Disease name	Evidence	Source
Unknown
Schizophrenia	Schizophrenia		GWAS
Cervical Cancer	Cervical Cancer	Our screens identified 10 miRNAs that enhance fitness of HeLa cells and have been reported to be up-regulated in cervical cancer (Table2).	GWAS, CBGDA
Metabolic Syndrome	Metabolic Syndrome		GWAS
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA
Diabetes	Diabetes		GWAS
Oligodendroglioma	Oligodendroglioma		GWAS
Biliary Atresia	Biliary Atresia		GWAS
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Bipolar Disorder	Associate	21876473
Colonic Neoplasms	Associate	34182539
Hypertension Pulmonary	Associate	26820968
Pterygium	Associate	40033254
Pulmonary Arterial Hypertension	Associate	23502781, 26820968

CBLN2 (cerebellin 2 precursor)