Gene Gene information from NCBI Gene database.
Entrez ID 147179
Gene name WAS/WASL interacting protein family member 2
Gene symbol WIPF2
Synonyms (NCBI Gene)
WICHWIRE
Chromosome 17
Chromosome location 17q21.2
Summary This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived
miRNA miRNA information provided by mirtarbase database.
1252
miRTarBase ID miRNA Experiments Reference
MIRT049127 hsa-miR-92a-3p CLASH 23622248
MIRT723480 hsa-miR-6858-3p HITS-CLIP 19536157
MIRT723479 hsa-miR-4323 HITS-CLIP 19536157
MIRT723478 hsa-miR-6736-3p HITS-CLIP 19536157
MIRT723477 hsa-miR-4267 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IEA
GO:0005515 Function Protein binding IPI 20936779, 21706016, 21988832, 23414517, 28514442, 31980649, 32296183, 33961781, 35271311
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0005856 Component Cytoskeleton IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609692 30923 ENSG00000171475
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TF74
Protein name WAS/WASL-interacting protein family member 2 (WASP-interacting protein-related protein) (WIP- and CR16-homologous protein) (WIP-related protein)
Protein function Plays an active role in the formation of cell surface protrusions downstream of activated PDGFB receptors. Plays an important role in actin-microspike formation through cooperation with WASL. May cooperate with WASP and WASL to induce mobilizati
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02205 WH2 34 60 WH2 motif Family
Tissue specificity TISSUE SPECIFICITY: Expressed mainly in brain, colon, lung and stomach (at protein level). Ubiquitously expressed, with high expression in brain, kidney, lung, and placenta. {ECO:0000269|PubMed:11829459, ECO:0000269|PubMed:12213210}.
Sequence
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRS
APILEKPKGSSGGYGSGGAALQPKGGLFQGGVLKLRPVGAKDGSENLAGKPALQIPSSRA
AAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIR
TGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPT
SASPSLLSNRPPPPARDPPSRGAAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPP
PPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQRI
YPSKTNRAARGAPPLPPILR
Sequence length 440
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Endocytosis
Pathogenic Escherichia coli infection
Yersinia infection
  Regulation of actin dynamics for phagocytic cup formation
RHO GTPases Activate WASPs and WAVEs
FCGR3A-mediated phagocytosis