Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
147138
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane channel like 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMC8
Synonyms (NCBI Gene) Gene synonyms aliases
EV2, EVER2, EVIN2
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121908330 G>A,T Risk-factor Coding sequence variant, stop gained, non coding transcript variant, missense variant
rs1567799639 G>C Risk-factor Splice donor variant
rs1598923748 G>- Pathogenic Frameshift variant, coding sequence variant, genic downstream transcript variant, non coding transcript variant, downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016489 hsa-miR-193b-3p Microarray 20304954
MIRT018436 hsa-miR-335-5p Microarray 18185580
MIRT1428130 hsa-miR-103a CLIP-seq
MIRT1428131 hsa-miR-107 CLIP-seq
MIRT1428132 hsa-miR-1184 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005515 Function Protein binding IPI 18158319, 30068544, 32917726
GO:0005615 Component Extracellular space HDA 22664934
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IDA 12426567
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605829 20474 ENSG00000167895
Protein
UniProt ID Q8IU68
Protein name Transmembrane channel-like protein 8 (Epidermodysplasia verruciformis protein 2)
Protein function Acts as a regulatory protein involved in the regulation of numerous cellular processes (PubMed:18158319, PubMed:23429285, PubMed:30068544, PubMed:32917726). Together with its homolog TMC6/EVER1, forms a complex with calcium-binding protein CIB1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07810 TMC 418 528 TMC domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, prostate and testis. {ECO:0000269|PubMed:12906855}.
Sequence
MLLPRSVSSERAPGVPEPEELWEAEMERLRGSGTPVRGLPYAMMDKRLIWQLREPAGVQT
LRWQRWQRRRQTVERRLREAAQRLARGLGLWEGALYEIGGLFGTGIRSYFTFLRFLLLLN
LLSLLLTASFVLLPLVWLRPPDPGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFT
NTYLFYGAYRVGPESSSVYSIRLAYLLSPLACLLLCFCGTLRRMVKGLPQKTLLGQGYQA
PLSAKVFSSWDFCIRVQEAATIKKHEISNEFKVELEEGRRFQLMQQQTRAQTACRLLSYL
RVNVLNGLLVVGAISAIFWATKYSQDNKEESLFLLLQYLPPGVIALVNFLGPLLFTFLVQ
LENYPPNTEVNLTLIWCVVLKLASLGMFSVSLGQTILCIGRDKSSCESYGYNVCDYQCWE
NSVGEELYKLSIFNFLLTVAFAFLVTLPRRLLVDRFSGRFWAWLEREEFLVPKNVLDIVA
GQTVTWMGLFYCPLLPLLNSVFLFLTFYIKKYTLLKNSRASSRPFRAS
SSTFFFQLVLLL
GLLLAAVPLGYVVSSIHSSWDCGLFTNYSAPWQVVPELVALGLPPIGQRALHYLGSHAFS
FPLLIMLSLVLTVCVSQTQANARAIHRLRKQLVWQVQEKWHLVEDLSRLLPEPGPSDSPG
PKYPASQASRPQSFCPGCPCPGSPGHQAPRPGPSVVDAAGLRSPCPGQHGAPASARRFRF
PSGAEL
Sequence length 726
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Epidermodysplasia Verruciformis Epidermodysplasia verruciformis, susceptibility to, 2, epidermodysplasia verruciformis rs121908330, rs1598895511, rs1598923748 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes (PheCode 250.2) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 34899684
Carcinoma Renal Cell Associate 37468683
Carcinoma Squamous Cell Associate 18224692, 25853559
Epidermodysplasia Verruciformis Associate 10844558, 17139267, 18158319, 18224692, 21387292, 22903682, 23429285, 24586810, 25378492, 25853559, 30068544, 32917957, 33818984, 35154113, 36170758
View all (1 more)
Head and Neck Neoplasms Associate 25853559
Immune System Diseases Associate 35154113
Infections Associate 25853559
Melanoma Associate 34899684
Neoplasms Squamous Cell Associate 24913986
Papillomavirus Infections Associate 18224692, 24586810, 25853559