Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	147
Gene name Gene Name - the full gene name approved by the HGNC.	Adrenoceptor alpha 1B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADRA1B
Synonyms (NCBI Gene) Gene synonyms aliases	ADRA1, ALPHA1BAR
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q33.3
Summary Summary of gene provided in NCBI Entrez Gene.	Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of whi

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047408	hsa-miR-10b-5p	CLASH	23622248
MIRT769805	hsa-miR-224	CLIP-seq
MIRT2470514	hsa-miR-3155	CLIP-seq
MIRT2470515	hsa-miR-3155b	CLIP-seq
MIRT2470516	hsa-miR-361-3p	CLIP-seq
MIRT2470517	hsa-miR-4467	CLIP-seq
MIRT2470518	hsa-miR-484	CLIP-seq
MIRT2470514	hsa-miR-3155	CLIP-seq
MIRT2470515	hsa-miR-3155b	CLIP-seq
MIRT2470516	hsa-miR-361-3p	CLIP-seq
MIRT2470517	hsa-miR-4467	CLIP-seq
MIRT2470518	hsa-miR-484	CLIP-seq

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004935	Function	Adrenergic receptor activity	IEA
GO:0004937	Function	Alpha1-adrenergic receptor activity	IBA
GO:0004937	Function	Alpha1-adrenergic receptor activity	IEA
GO:0004937	Function	Alpha1-adrenergic receptor activity	TAS	1328250
GO:0005515	Function	Protein binding	IPI	24567387
GO:0005634	Component	Nucleus	IDA	22120526
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	24567387
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24567387
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1328250
GO:0005901	Component	Caveola	IEA
GO:0006937	Process	Regulation of muscle contraction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	2154750
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	10820200
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007267	Process	Cell-cell signaling	IBA
GO:0007267	Process	Cell-cell signaling	TAS	1328250
GO:0016020	Component	Membrane	IEA
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0031965	Component	Nuclear membrane	IDA	22120526
GO:0031965	Component	Nuclear membrane	IEA
GO:0035556	Process	Intracellular signal transduction	TAS	10820200
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	22120526
GO:0046982	Function	Protein heterodimerization activity	IDA	22120526
GO:0055117	Process	Regulation of cardiac muscle contraction	IEA
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA
GO:0150099	Process	Neuron-glial cell signaling	ISS

MIM	HGNC	e!Ensembl
104220	278	ENSG00000170214

Protein

UniProt ID

P35368

Protein name

Alpha-1B adrenergic receptor (Alpha-1B adrenoreceptor) (Alpha-1B adrenoceptor)

Protein function

This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regu

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	62 → 348	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF

Sequence length

520

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cGMP-PKG signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Adrenergic signaling in cardiomyocytes Vascular smooth muscle contraction Salivary secretion		Adrenoceptors G alpha (q) signalling events G alpha (12/13) signalling events

ADRA1B (adrenoceptor alpha 1B)