Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	147
Gene name Gene Name - the full gene name approved by the HGNC.	Adrenoceptor alpha 1B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADRA1B
Synonyms (NCBI Gene) Gene synonyms aliases	ADRA1, ALPHA1BAR
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q33.3
Summary Summary of gene provided in NCBI Entrez Gene.	Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of whi

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047408	hsa-miR-10b-5p	CLASH	23622248
MIRT769805	hsa-miR-224	CLIP-seq
MIRT2470514	hsa-miR-3155	CLIP-seq
MIRT2470515	hsa-miR-3155b	CLIP-seq
MIRT2470516	hsa-miR-361-3p	CLIP-seq
MIRT2470517	hsa-miR-4467	CLIP-seq
MIRT2470518	hsa-miR-484	CLIP-seq
MIRT2470514	hsa-miR-3155	CLIP-seq
MIRT2470515	hsa-miR-3155b	CLIP-seq
MIRT2470516	hsa-miR-361-3p	CLIP-seq
MIRT2470517	hsa-miR-4467	CLIP-seq
MIRT2470518	hsa-miR-484	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001996	Process	Positive regulation of heart rate by epinephrine-norepinephrine	IBA	21873635
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004937	Function	Alpha1-adrenergic receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	22723743, 24567387, 25775528, 28862946, 29426850
GO:0005634	Component	Nucleus	IDA	22120526
GO:0005737	Component	Cytoplasm	IDA	24567387
GO:0005886	Component	Plasma membrane	IDA	24567387
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005901	Component	Caveola	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	10820200
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0007267	Process	Cell-cell signaling	IBA	21873635
GO:0031965	Component	Nuclear membrane	IDA	22120526
GO:0035556	Process	Intracellular signal transduction	TAS	10820200
GO:0043410	Process	Positive regulation of MAPK cascade	IBA	21873635
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	22120526
GO:0045907	Process	Positive regulation of vasoconstriction	IBA	21873635
GO:0046982	Function	Protein heterodimerization activity	IDA	22120526
GO:0055117	Process	Regulation of cardiac muscle contraction	IEA
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	21873635
GO:0150099	Process	Neuron-glial cell signaling	ISS

MIM	HGNC	e!Ensembl
104220	278	ENSG00000170214

Protein

UniProt ID

P35368

Protein name

Alpha-1B adrenergic receptor (Alpha-1B adrenoreceptor) (Alpha-1B adrenoceptor)

Protein function

This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regu

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	62 → 348	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF

Sequence length

520

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cGMP-PKG signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Adrenergic signaling in cardiomyocytes Vascular smooth muscle contraction Salivary secretion		Adrenoceptors G alpha (q) signalling events G alpha (12/13) signalling events

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Kidney disease	Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	18257748
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061 View all (179 more)	19125850

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Attention Deficit Disorder with Hyperactivity	Associate	21368917
Colorectal Neoplasms	Associate	17242706
Complex Regional Pain Syndromes	Associate	37848097
Coronary Disease	Associate	37679988
Heart Murmurs	Associate	22615923
Hyperplasia	Inhibit	9915474
Hypertension	Associate	22615923
Inflammation	Associate	37848097
Lung Neoplasms	Associate	38066059
Polycystic Ovary Syndrome	Associate	34720019
Stomach Neoplasms	Inhibit	17242706

ADRA1B (adrenoceptor alpha 1B)