CST1 (cystatin SN)

Gene

• Entrez ID: 1469
• Gene name: Cystatin SN
• Gene symbol: CST1
• Synonyms (NCBI Gene): -
• Chromosome: 20
• Chromosome location: 20p11.21
• Summary: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018277	hsa-miR-335-5p	Microarray	18185580
MIRT913277	hsa-miR-3065-5p	CLIP-seq
MIRT913278	hsa-miR-3173-5p	CLIP-seq
MIRT913279	hsa-miR-339-3p	CLIP-seq
MIRT913280	hsa-miR-370	CLIP-seq
MIRT913281	hsa-miR-4663	CLIP-seq
MIRT2206604	hsa-miR-4269	CLIP-seq
MIRT2206605	hsa-miR-4300	CLIP-seq
MIRT2206606	hsa-miR-4447	CLIP-seq
MIRT2206607	hsa-miR-4472	CLIP-seq
MIRT2206608	hsa-miR-4488	CLIP-seq
MIRT2206609	hsa-miR-455-3p	CLIP-seq
MIRT2206610	hsa-miR-4651	CLIP-seq
MIRT2206611	hsa-miR-4685-5p	CLIP-seq
MIRT2206612	hsa-miR-4697-5p	CLIP-seq
MIRT2206613	hsa-miR-4717-3p	CLIP-seq
MIRT2206614	hsa-miR-608	CLIP-seq
MIRT2206615	hsa-miR-920	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	24248522
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IBA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	TAS	3446578
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	24248522
GO:0005737	Component	Cytoplasm	IBA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031982	Component	Vesicle	IBA

Other IDs

• MIM: 123855
• HGNC: 2473
• e!Ensembl: ENSG00000170373

Protein

• UniProt ID: P01037
• Protein name: Cystatin-SN (Cystain-SA-I) (Cystatin-1) (Salivary cystatin-SA-1)
• Protein function: Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better in
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00031	Cystatin	32 → 127	Cystatin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid. {ECO:0000269|PubMed:20189825}.
• Sequence:

  MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATK
  DDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF
  EIYEVPWENRRSLVKSRCQES

• Sequence length: 141

Pathways

KEGG:

Salivary secretion