Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1469
Gene name Gene Name - the full gene name approved by the HGNC.	Cystatin SN
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CST1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory

Show/Hide all(18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018277	hsa-miR-335-5p	Microarray	18185580
MIRT913277	hsa-miR-3065-5p	CLIP-seq
MIRT913278	hsa-miR-3173-5p	CLIP-seq
MIRT913279	hsa-miR-339-3p	CLIP-seq
MIRT913280	hsa-miR-370	CLIP-seq
MIRT913281	hsa-miR-4663	CLIP-seq
MIRT2206604	hsa-miR-4269	CLIP-seq
MIRT2206605	hsa-miR-4300	CLIP-seq
MIRT2206606	hsa-miR-4447	CLIP-seq
MIRT2206607	hsa-miR-4472	CLIP-seq
MIRT2206608	hsa-miR-4488	CLIP-seq
MIRT2206609	hsa-miR-455-3p	CLIP-seq
MIRT2206610	hsa-miR-4651	CLIP-seq
MIRT2206611	hsa-miR-4685-5p	CLIP-seq
MIRT2206612	hsa-miR-4697-5p	CLIP-seq
MIRT2206613	hsa-miR-4717-3p	CLIP-seq
MIRT2206614	hsa-miR-608	CLIP-seq
MIRT2206615	hsa-miR-920	CLIP-seq

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	24248522
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IBA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	TAS	3446578
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	24248522
GO:0005737	Component	Cytoplasm	IBA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031982	Component	Vesicle	IBA

MIM	HGNC	e!Ensembl
123855	2473	ENSG00000170373

Protein

UniProt ID

P01037

Protein name

Cystatin-SN (Cystain-SA-I) (Cystatin-1) (Salivary cystatin-SA-1)

Protein function

Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better in

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00031	Cystatin	32 → 127	Cystatin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid. {ECO:0000269|PubMed:20189825}.

Sequence

MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATK
DDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF
EIYEVPWENRRSLVKSRCQES

Sequence length

141

Interactions

View interactions

	KEGG
	Salivary secretion

CST1 (cystatin SN)