CSRP2 (cysteine and glycine rich protein 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 1466
Gene name Cysteine and glycine rich protein 2
Gene symbol CSRP2
Synonyms (NCBI Gene)
CRP2LMO5SmLIM
Chromosome 12
Chromosome location 12q21.2
Summary CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence
miRNA miRNA information provided by mirtarbase database.
163
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (163)
miRTarBase ID miRNA Experiments Reference
MIRT478699 hsa-miR-199b-3p PAR-CLIP 21572407
MIRT478698 hsa-miR-199a-3p PAR-CLIP 21572407
MIRT478697 hsa-miR-3129-5p PAR-CLIP 21572407
MIRT478696 hsa-miR-216a-3p PAR-CLIP 21572407
MIRT478695 hsa-miR-128-3p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (14)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus NAS 8626582
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601871 2470 ENSG00000175183
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16527
Protein name Cysteine and glycine-rich protein 2 (Cysteine-rich protein 2) (CRP2) (LIM domain only protein 5) (LMO-5) (Smooth muscle cell LIM protein) (SmLIM)
Protein function Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Seems to play a role in the development of the embryonic vascular system.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 10 → 66 LIM domain Domain
PF00412 LIM 119 → 175 LIM domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in the aorta, but not in heart and skeletal muscle.
Sequence 
MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKS
CYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCS
RCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGF
GYGQGAGALVHAQ
Sequence length 193
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  Cytoskeleton in muscle cells  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
6
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (6)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASTHMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GLIOMA — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (5)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Carcinoma Hepatocellular Associate 12079511
★★★★★
★☆☆☆☆
Found in Text Mining only
Leukemia Biphenotypic Acute Stimulate 39952599
★★★★★
★☆☆☆☆
Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell Associate 12079511
★★★★★
★☆☆☆☆
Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma Associate 37183704
★★★★★
★☆☆☆☆
Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck Associate 31391008, 34585646
★★★★★
★☆☆☆☆
Found in Text Mining only