Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1465
Gene name Gene Name - the full gene name approved by the HGNC.
Cysteine and glycine rich protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CSRP1
Synonyms (NCBI Gene) Gene synonyms aliases
CRP, CRP1, CSRP, CYRP, D1S181E, HEL-141, HEL-S-286
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-fing
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001373 hsa-miR-1-3p pSILAC 18668040
MIRT022790 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT023316 hsa-miR-122-5p Microarray 17612493
MIRT001373 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT001373 hsa-miR-1-3p Proteomics 18668040
Transcription factors
Transcription factor Regulation Reference
CEBPB Activation 14522018
HNF1A Unknown 18292576
REL Activation 14522018
STAT3 Activation 8621622
STAT3 Unknown 18292576
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 26924529
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
123876 2469 ENSG00000159176
Protein
UniProt ID P21291
Protein name Cysteine and glycine-rich protein 1 (Cysteine-rich protein 1) (CRP) (CRP1) (Epididymis luminal protein 141) (HEL-141)
Protein function Could play a role in neuronal development.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 10 66 LIM domain Domain
PF00412 LIM 119 175 LIM domain Domain
Sequence
MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKS
CYGKKY
GPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP
RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNF
GPKGF
GFGQGAGALVHSE
Sequence length 193
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Cytoskeleton in muscle cells  
<