BEAN1 (brain expressed associated with NEDD4 1)

Gene

• Entrez ID: 146227
• Gene name: Brain expressed associated with NEDD4 1
• Gene symbol: BEAN1
• Synonyms (NCBI Gene): BEAN, SCA31
• Chromosome: 16
• Chromosome location: 16q21
• Summary: The protein encoded by this gene is one of several proteins that interact with NEDD4, a member of a family of ubiquitin-protein ligases. These proteins have PY motifs in common that bind to the WW domains of NEDD4. NEDD4 is developmentally regulated, and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT820639	hsa-miR-3134	CLIP-seq
MIRT820640	hsa-miR-3688-3p	CLIP-seq
MIRT820641	hsa-miR-4520a-5p	CLIP-seq
MIRT820642	hsa-miR-4520b-5p	CLIP-seq
MIRT820643	hsa-miR-4534	CLIP-seq
MIRT820644	hsa-miR-1208	CLIP-seq
MIRT820645	hsa-miR-198	CLIP-seq
MIRT820646	hsa-miR-4645-5p	CLIP-seq
MIRT820647	hsa-miR-4659a-5p	CLIP-seq
MIRT820648	hsa-miR-4659b-5p	CLIP-seq
MIRT820649	hsa-miR-4673	CLIP-seq
MIRT820650	hsa-miR-4769-3p	CLIP-seq
MIRT1942511	hsa-miR-1285	CLIP-seq
MIRT1942512	hsa-miR-1343	CLIP-seq
MIRT1942513	hsa-miR-3135	CLIP-seq
MIRT1942514	hsa-miR-3187-5p	CLIP-seq
MIRT1942515	hsa-miR-34a	CLIP-seq
MIRT1942516	hsa-miR-34c-5p	CLIP-seq
MIRT1942517	hsa-miR-449a	CLIP-seq
MIRT1942518	hsa-miR-449b	CLIP-seq
MIRT1942519	hsa-miR-4757-5p	CLIP-seq
MIRT1942520	hsa-miR-4774-3p	CLIP-seq
MIRT1942521	hsa-miR-612	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 612051
• HGNC: 24160
• e!Ensembl: ENSG00000166546

Protein

• UniProt ID: Q3B7T3
• Protein name: Protein BEAN1 (Brain-expressed protein associating with Nedd4 homolog) (BEAN)
• Sequence:

  MSFKRPCPLARYNRTSYFYPTFSESSEHSHLLVSPVLVASAVIGVVIILSCITIIVGSIR
  RDRQARLQRHRHRHHRHHHHHHHHRRRRHREYEHGYVSDEHTYSRSSRRMRYACSSSEDW
  PPPLDISSDGDVDATVLRELYPDSPPGYEECVGPGATQLYVPTDAPPPYSLTDSCPTLDG
  TSDSGSGHSPGRHQQEQRTPAQGGLHTVSMDTLPPYEAVCGAGPPSGLLPLPGPDPGPRG
  SQGSPTPTRAPASGPERIV

• Sequence length: 259

Pathways

KEGG:

Spinocerebellar ataxia

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
BEAN1-related disorder	Likely benign; Benign	rs141546513, rs527873790, rs72788593, rs564817056, rs146861397, rs115852696, rs779019822, rs911363927	RCV003929200 RCV003923909 RCV003929740 RCV003963924 RCV003949408 RCV003979157 RCV003971488 RCV003967098
Spinocerebellar ataxia type 31	Benign	rs529552966	RCV004579667

Associations from Text Mining
Disease Name	Relationship Type	References
Ataxia	Associate	21088341
Spinocerebellar Ataxia 31	Associate	19878914, 30634945