CMTM2 (CKLF like MARVEL transmembrane domain containing 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 146225
Gene name CKLF like MARVEL transmembrane domain containing 2
Gene symbol CMTM2
Synonyms (NCBI Gene)
CKLFSF2
Chromosome 16
Chromosome location 16q21
Summary This gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. [
miRNA miRNA information provided by mirtarbase database.
3
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (3)
miRTarBase ID miRNA Experiments Reference
MIRT021338 hsa-miR-9-5p Microarray 17612493
MIRT898834 hsa-miR-1324 CLIP-seq
MIRT898835 hsa-miR-3942-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005615 Component Extracellular space IEA
GO:0006935 Process Chemotaxis IEA
GO:0007165 Process Signal transduction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
607885 19173 ENSG00000140932
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TAZ6
Protein name CKLF-like MARVEL transmembrane domain-containing protein 2 (Chemokine-like factor superfamily member 2)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in testis. {ECO:0000269|PubMed:12782130}.
Sequence 
MAPKAAKGAKPEPAPAPPPPGAKPEEDKKDGKEPSDKPQKAVQDHKEPSDKPQKAVQPKH
EVGTRRGCRRYRWELKDSNKEFWLLGHAEIKIRSLGCLIAAMILLSSLTVHPILRLIITM
EISFFSFFILLYSFAIHRYIPFILWPISDLFNDLIACAFLVGAVVFAVRSRRSMNLHYLL
AVILIGAAGVFAFIDVCLQRNHFRGKKAKKHMLVPPPGKEKGPQQGKGPEPAKPPEPGKP
PGPAKGKK
Sequence length 248
Interactions View interactions