CMTM2 (CKLF like MARVEL transmembrane domain containing 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
146225
Gene name Gene Name - the full gene name approved by the HGNC.
CKLF like MARVEL transmembrane domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CMTM2
Synonyms (NCBI Gene) Gene synonyms aliases
CKLFSF2
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. [
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(3)
miRTarBase ID miRNA Experiments Reference
MIRT021338 hsa-miR-9-5p Microarray 17612493
MIRT898834 hsa-miR-1324 CLIP-seq
MIRT898835 hsa-miR-3942-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005615 Component Extracellular space IEA
GO:0006935 Process Chemotaxis IEA
GO:0007165 Process Signal transduction IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
607885 19173 ENSG00000140932
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8TAZ6
Protein name CKLF-like MARVEL transmembrane domain-containing protein 2 (Chemokine-like factor superfamily member 2)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in testis. {ECO:0000269|PubMed:12782130}.
Sequence 
MAPKAAKGAKPEPAPAPPPPGAKPEEDKKDGKEPSDKPQKAVQDHKEPSDKPQKAVQPKH
EVGTRRGCRRYRWELKDSNKEFWLLGHAEIKIRSLGCLIAAMILLSSLTVHPILRLIITM
EISFFSFFILLYSFAIHRYIPFILWPISDLFNDLIACAFLVGAVVFAVRSRRSMNLHYLL
AVILIGAAGVFAFIDVCLQRNHFRGKKAKKHMLVPPPGKEKGPQQGKGPEPAKPPEPGKP
PGPAKGKK
Sequence length 248
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Show/Hide Text Mining Associations (13)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32688456, 35246970
Alzheimer Disease Associate 37545529
Antiphospholipid Syndrome Associate 32195671
Arthritis Rheumatoid Associate 32195671
Carcinoma Hepatocellular Inhibit 36975415
Carcinoma Lewis Lung Inhibit 32688456
Colorectal Neoplasms Associate 22901147
Hepatitis B Associate 33101541
Neoplasms Inhibit 32688456
Scleroderma Systemic Associate 32195671