Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
146198
Gene name Gene Name - the full gene name approved by the HGNC.
ZFP90 zinc finger protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZFP90
Synonyms (NCBI Gene) Gene synonyms aliases
FIK, NK10, ZNF756, zfp-90
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the zinc finger protein family that modulates gene expression. The encoded protein derepresses the transcription of certain fetal cardiac genes and may contribute to the genetic reprogramming that occurs during the developmen
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT045216 hsa-miR-186-5p CLASH 23622248
MIRT1511789 hsa-miR-1178 CLIP-seq
MIRT1511790 hsa-miR-1182 CLIP-seq
MIRT1511791 hsa-miR-1183 CLIP-seq
MIRT1511792 hsa-miR-1205 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA 21873635
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IBA 21873635
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609451 23329 ENSG00000184939
Protein
UniProt ID Q8TF47
Protein name Zinc finger protein 90 homolog (Zfp-90) (Zinc finger protein 756)
Protein function Inhibits the transcriptional repressor activity of REST by inhibiting its binding to DNA, thereby derepressing transcription of REST target genes. ; [Isoform 2]: Acts as a bridge between FOXP3 and the core
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 13 54 KRAB box Family
PF00096 zf-C2H2 211 233 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 282 304 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 310 332 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 338 360 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 366 388 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 394 416 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 450 472 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 497 519 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 525 547 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 553 575 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 581 603 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 609 631 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart (PubMed:21284946). Isoform 2: Highly expressed in regulatory T-cells (Treg) (PubMed:23543754). {ECO:0000269|PubMed:21284946, ECO:0000269|PubMed:23543754}.
Sequence
MAPRPPTAAPQESVTFKDVSVDFTQEEWYHVDPAQRSLYRDVMLENYSHLVSLGYQVSKP
EVIFKLEQGEEPWISEGEIQRPFYPDWKTRPEVKSSHLQQDVSEVSHCTHDLLHATLEDS
WDVSSQLDRQQENWKRHLGSEASTQKKIITPQENFEQNKFGENSRLNTNLVTQLNIPARI
RPSECETLGSNLGHNADLLNENNILAKKKPYKCDKCRKAFIHRSSLTKHEKTHKGEGAFP
NGTDQGIYPGKKHHECTDCGKTFLWKTQLTEHQRIHTGEKPFECNVCGKAFRHSSSLGQH
ENAH
TGEKPYQCSLCGKAFQRSSSLVQHQRIHTGEKPYRCNLCGRSFRHGTSLTQHEVTH
SGEKPFQCKECGKAFSRCSSLVQHERTHTGEKPFECSICGRAFGQSPSLYKHMRIHKRGK
PYQSSNYSIDFKHSTSLTQDESTLTEVKSYHCNDCGEDFSHITDFTDHQRIHTAENPYDC
EQAFSQQAISHPGEKPYQCNVCGKAFKRSTSFIEHHRIHTGEKPYECNECGEAFSRRSSL
TQHERTH
TGEKPYECIDCGKAFSQSSSLIQHERTHTGEKPYECNECGRAFRKKTNLHDHQ
RIH
TGEKPYSCKECGKNFSRSSALTKHQRIHTRNKL
Sequence length 636
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)
22190364
Unknown
Disease term Disease name Evidence References Source
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Ulcerative colitis Ulcerative colitis GWAS
Inflammatory Bowel Disease Inflammatory Bowel Disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Associate 33796098
Colitis Ulcerative Associate 24956270
Colorectal Neoplasms Associate 21531788
Fibrosis Associate 31311600
Inflammatory Bowel Diseases Associate 35018451
Lupus Erythematosus Systemic Associate 33796098
Melanoma Associate 30333196
Non alcoholic Fatty Liver Disease Associate 31311600
Serositis Associate 33796098
Skin Neoplasms Associate 35018451