Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	146057
Gene name Gene Name - the full gene name approved by the HGNC.	Tau tubulin kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TTBK2
Synonyms (NCBI Gene) Gene synonyms aliases	SCA11, TTBK
Disease Acronyms (UniProt) Disease acronyms from UniProt database	SCA11
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q15.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a serine-threonine kinase that putatively phosphorylates tau and tubulin proteins. Mutations in this gene cause spinocerebellar ataxia type 11 (SCA11); a neurodegenerative disease characterized by progressive ataxia and atrophy of the ce

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs80356538	->T	Pathogenic	Coding sequence variant, frameshift variant
rs80356539	CT>-	Pathogenic	Coding sequence variant, frameshift variant
rs199635198	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, synonymous variant
rs318240735	CT>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(25)

miRTarBase ID	miRNA	Experiments
MIRT1460779	hsa-miR-1273d	CLIP-seq
MIRT1460780	hsa-miR-3154	CLIP-seq
MIRT1460781	hsa-miR-410	CLIP-seq
MIRT1460782	hsa-miR-4307	CLIP-seq
MIRT1460783	hsa-miR-4768-5p	CLIP-seq
MIRT2138396	hsa-miR-3152-5p	CLIP-seq
MIRT2138397	hsa-miR-3974	CLIP-seq
MIRT2138398	hsa-miR-4263	CLIP-seq
MIRT2138399	hsa-miR-4320	CLIP-seq
MIRT2138400	hsa-miR-4774-3p	CLIP-seq
MIRT2138401	hsa-miR-520d-5p	CLIP-seq
MIRT2138402	hsa-miR-524-5p	CLIP-seq
MIRT2138403	hsa-miR-596	CLIP-seq
MIRT2138398	hsa-miR-4263	CLIP-seq
MIRT2138399	hsa-miR-4320	CLIP-seq
MIRT2359303	hsa-miR-4690-3p	CLIP-seq
MIRT2138401	hsa-miR-520d-5p	CLIP-seq
MIRT2138402	hsa-miR-524-5p	CLIP-seq
MIRT2359304	hsa-miR-548n	CLIP-seq
MIRT2359305	hsa-miR-548t	CLIP-seq
MIRT2138398	hsa-miR-4263	CLIP-seq
MIRT2396448	hsa-miR-4799-5p	CLIP-seq
MIRT2396449	hsa-miR-576-5p	CLIP-seq
MIRT2138403	hsa-miR-596	CLIP-seq
MIRT2138403	hsa-miR-596	CLIP-seq

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IGI	26323690
GO:0004672	Function	Protein kinase activity	IDA	26323690
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	21548880
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	28386764
GO:0005515	Function	Protein binding	IPI	22863007, 25416956, 26323690, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	21548880
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005814	Component	Centriole	IDA	23141541
GO:0005829	Component	Cytosol	IDA	21548880
GO:0005829	Component	Cytosol	TAS
GO:0007026	Process	Negative regulation of microtubule depolymerization	IDA	26323690
GO:0007224	Process	Smoothened signaling pathway	ISS
GO:0018105	Process	Peptidyl-serine phosphorylation	IBA	21873635
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	21548880, 26323690
GO:0019894	Function	Kinesin binding	IPI	26323690
GO:0021549	Process	Cerebellum development	ISS	26323690
GO:0021681	Process	Cerebellar granular layer development	ISS	26323690
GO:0021935	Process	Cerebellar granule cell precursor tangential migration	ISS	26323690
GO:0030334	Process	Regulation of cell migration	IGI	26323690
GO:0035869	Component	Ciliary transition zone	IBA	21873635
GO:0035869	Component	Ciliary transition zone	IDA	23141541
GO:0035869	Component	Ciliary transition zone	ISS
GO:0036064	Component	Ciliary basal body	IBA	21873635
GO:0036064	Component	Ciliary basal body	ISS
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050321	Function	Tau-protein kinase activity	TAS	26323690
GO:0051010	Function	Microtubule plus-end binding	TAS	26323690
GO:0060271	Process	Cilium assembly	IBA	21873635
GO:0060271	Process	Cilium assembly	IMP	23141541
GO:0060271	Process	Cilium assembly	ISS
GO:0097711	Process	Ciliary basal body-plasma membrane docking	TAS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:1902817	Process	Negative regulation of protein localization to microtubule	IMP	26323690
GO:1904527	Process	Negative regulation of microtubule binding	IDA	26323690

MIM	HGNC	e!Ensembl
611695	19141	ENSG00000128881

Protein

UniProt ID

Q6IQ55

Protein name

Tau-tubulin kinase 2 (EC 2.7.11.1)

Protein function

Serine/threonine kinase that acts as a key regulator of ciliogenesis: controls the initiation of ciliogenesis by binding to the distal end of the basal body and promoting the removal of CCP110, which caps the mother centriole, leading to the rec

PDB

6U0K , 6VRF , 7O3B , 7Q8Y , 7Q8Z , 7Q90

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	21 → 272	Protein kinase domain	Domain

Sequence

MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQV
LKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLR
LGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPP
RAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKE
RYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWEKT
GNDGSLTTTTTSTTPQLHTRLTPAAIGIANATPIPGDLLRENTDEVFPDEQLSDGENGIP
VGVSPDKLPGSLGHPRPQEKDVWEEMDANKNKIKLGICKAATEEENSHGQANGLLNAPSL
GSPIRVRSEITQPDRDIPLVRKLRSIHSFELEKRLTLEPKPDTDKFLETCLEKMQKDTSA
GKESILPALLHKPCVPAVSRTDHIWHYDEEYLPDASKPASANTPEQADGGGSNGFIAVNL
SSCKQEIDSKEWVIVDKEQDLQDFRTNEAVGHKTTGSPSDEEPEVLQVLEASPQDEKLQL
GPWAENDHLKKETSGVVLALSAEGPPTAASEQYTDRLELQPGAASQFIAATPTSLMEAQA
EGPLTAITIPRPSVASTQSTSGSFHCGQQPEKKDLQPMEPTVELYSPRENFSGLVVTEGE
PPSGGSRTDLGLQIDHIGHDMLPNIRESNKSQDLGPKELPDHNRLVVREFENLPGETEEK
SILLESDNEDEKLSRGQHCIEISSLPGDLVIVEKDHSATTEPLDVTKTQTFSVVPNQDKN
NEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFL
HQEGKREKITPRNGELFHCVSENEHGAPTRKDMVRSSFVTRHSRIPVLAQEIDSTLESSS
PVSAKEKLLQKKAYQPDLVKLLVEKRQFKSFLGDLSSASDKLLEEKLATVPAPFCEEEVL
TPFSRLTVDSHLSRSAEDSFLSPIISQSRKSKIPRPVSWVNTDQVNSSTSSQFFPRPPPG
KPPTRPGVEARLRRYKVLGSSNSDSDLFSRLAQILQNGSQKPRSTTQCKSPGSPHNPKTP
PKSPVVPRRSPSASPRSSSLPRTSSSSPSRAGRPHHDQRSSSPHLGRSKSPPSHSGSSSS
RRSCQQEHCKPSKNGLKGSGSLHHHSASTKTPQGKSKPASKLSR

Sequence length

1244

Interactions

View interactions

	Reactome
			Anchoring of the basal body to the plasma membrane

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Spinocerebellar ataxia	Ataxia, Spinocerebellar, Spinocerebellar Ataxia Type 1, Spinocerebellar Ataxia Type 2, Spinocerebellar Ataxia Type 4, Spinocerebellar Ataxia Type 5, Spinocerebellar Ataxia Type 6 (disorder), Spinocerebellar Ataxia Type 7, SPINOCEREBELLAR ATAXIA 11, Spinocerebellar ataxia type 11	rs80356538, rs80356539, rs56144125, rs28937887, rs80356544, rs80356540, rs80356542, rs1941485201, rs121918306, rs151344520, rs151344519, rs151344521, rs151344523, rs151344512, rs193922926 View all (203 more)	18037885
Cerebellar ataxia	Progressive cerebellar ataxia	rs28936415, rs199476133, rs540331226, rs797046006, rs863224069, rs138358708, rs1057519429, rs750959420, rs1568440440, rs1597846084, rs759460806, rs761486324, rs1240335250, rs1596489887
Lung carcinoma	Small cell carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)
Nystagmus	Nystagmus	rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Bipolar Disorder	Bipolar Disorder			GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Amyotrophic Lateral Sclerosis	Associate	37059819
Ataxia	Associate	24030952
Ciliopathies	Associate	34499853
Glioma	Associate	28219405, 31858557, 32196629
Machado Joseph Disease	Associate	10417284
Spinocerebellar Ataxias	Associate	39930500
Spinocerebellar Degenerations	Associate	24030952

TTBK2 (tau tubulin kinase 2)