Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1460
Gene name Gene Name - the full gene name approved by the HGNC.	Casein kinase 2 beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CSNK2B
Synonyms (NCBI Gene) Gene synonyms aliases	CK2B, CK2N, CSK2B, Ckb1, Ckb2, G5A, POBINDS
Disease Acronyms (UniProt) Disease acronyms from UniProt database	POBINDS
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta

Show/Hide all(3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1562050885	G>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1583608433	G>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1583608557	C>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments
MIRT912886	hsa-miR-1224-3p	CLIP-seq
MIRT912887	hsa-miR-1260	CLIP-seq
MIRT912888	hsa-miR-1260b	CLIP-seq
MIRT912889	hsa-miR-1279	CLIP-seq
MIRT912890	hsa-miR-1280	CLIP-seq
MIRT912891	hsa-miR-188-3p	CLIP-seq
MIRT912892	hsa-miR-3156-3p	CLIP-seq
MIRT912893	hsa-miR-3938	CLIP-seq
MIRT912894	hsa-miR-4659a-3p	CLIP-seq
MIRT912895	hsa-miR-4659b-3p	CLIP-seq
MIRT912896	hsa-miR-4775	CLIP-seq
MIRT2206523	hsa-miR-4766-5p	CLIP-seq
MIRT2206524	hsa-miR-488	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
ETS1	Unknown	11389726

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003682	Function	Chromatin binding	IDA	25519132
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	15723517
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	1856204, 28031292
GO:0005102	Function	Signaling receptor binding	IPI	19233263, 19592636
GO:0005515	Function	Protein binding	IPI	10094392, 11574463, 12769847, 14667819, 16977309, 19011756, 20664522, 21078624, 21282530, 21968188, 21988832, 23455922, 23555304, 24535599, 25519132, 25852190, 26496610, 26562092, 26711270, 27705803, 29997244, 31980649, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	21282530
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	19233263
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	19233263
GO:0005956	Component	Protein kinase CK2 complex	IBA	21873635
GO:0005956	Component	Protein kinase CK2 complex	IDA	15723517
GO:0005956	Component	Protein kinase CK2 complex	NAS	2666134
GO:0006457	Process	Protein folding	TAS
GO:0006656	Process	Phosphatidylcholine biosynthetic process	TAS
GO:0007165	Process	Signal transduction	TAS	2513884
GO:0008134	Function	Transcription factor binding	IPI	19324893
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	19324893
GO:0010862	Process	Positive regulation of pathway-restricted SMAD protein phosphorylation	IDA	19592636
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016236	Process	Macroautophagy	TAS
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	15723517
GO:0019887	Function	Protein kinase regulator activity	IBA	21873635
GO:0019887	Function	Protein kinase regulator activity	NAS	2666134
GO:0019904	Function	Protein domain specific binding	IPI	11984006
GO:0031519	Component	PcG protein complex	IDA	21282530
GO:0032927	Process	Positive regulation of activin receptor signaling pathway	IMP	19592636
GO:0033211	Process	Adiponectin-activated signaling pathway	IDA	19233263
GO:0034622	Process	Cellular protein-containing complex assembly	NAS	19324893
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042802	Function	Identical protein binding	IPI	10094392, 14667819, 21282530, 21988832, 23555304
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	19592636
GO:0045859	Process	Regulation of protein kinase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051101	Process	Regulation of DNA binding	NAS	19324893
GO:0061154	Process	Endothelial tube morphogenesis	IMP	19592636
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
115441	2460	ENSG00000204435

Protein

UniProt ID

P67870

Protein name

Casein kinase II subunit beta (CK II beta) (Phosvitin) (Protein G5a)

Protein function

Regulatory subunit of casein kinase II/CK2. As part of the kinase complex regulates the basal catalytic activity of the alpha subunit a constitutively active serine/threonine-protein kinase that phosphorylates a large number of substrates contai

PDB

1DS5 , 1JWH , 1QF8 , 3EED , 4DGL , 4MD7 , 4MD8 , 4MD9 , 4NH1 , 6Q38

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01214	CK_II_beta	8 → 191	Casein kinase II regulatory subunit	Domain

Sequence

MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR

Sequence length

215

Interactions

View interactions

	KEGG		Reactome
	Ribosome biogenesis in eukaryotes Polycomb repressive complex NF-kappa B signaling pathway Mitophagy - animal Wnt signaling pathway Adherens junction Alzheimer disease Prion disease Pathways of neurodegeneration - multiple diseases Measles PD-L1 expression and PD-1 checkpoint pathway in cancer		Synthesis of PC WNT mediated activation of DVL Condensation of Prometaphase Chromosomes Signal transduction by L1 Neutrophil degranulation Regulation of TP53 Activity through Phosphorylation Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding Receptor Mediated Mitophagy RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known Regulation of PTEN stability and activity

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Carcinoma	Squamous cell carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	18572023
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	17632545
Non-syndromic intellectual disability	Autosomal dominant non-syndromic intellectual disability	rs121918049, rs1135401819, rs1553638614, rs1561846159, rs1564493599, rs1563978827
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	21156761

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Non-Syndromic Intellectual Disability	autosomal dominant non-syndromic intellectual disability	GenCC
Systemic lupus erythematosus	Systemic lupus erythematosus	GWAS

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References
Associations from Text Mining
Body Dysmorphic Disorders	Associate	35205321
Breast Neoplasms	Associate	25486430, 27527857
Carcinoma Hepatocellular	Associate	36157211, 36617978
Cholangiocarcinoma	Associate	23828693
Colorectal Neoplasms	Associate	16207476
Congenital Abnormalities	Associate	34983633
Developmental Disabilities	Associate	31784560, 34041744, 34983633, 40317201
Distal myopathy Nonaka type	Associate	34983633
Drug Resistant Epilepsy	Associate	27094248, 34983633
Endometrial Neoplasms	Associate	19056846
Epilepsy	Associate	31784560, 34041744, 35205321, 40211296
Facial Dysmorphism with Multiple Malformations	Associate	34983633
Hypoxia	Associate	37020036
Intellectual Disability	Associate	31784560, 34041744, 34983633, 35205321, 36833176, 40211296, 40317201
Learning Disabilities	Associate	34041744
Mohr Tranebjaerg syndrome	Associate	27094248
Muscle Hypotonia	Associate	34983633
Neoplasm Invasiveness	Stimulate	25541719
Neoplasms	Associate	23828693
Polydactyly Postaxial	Associate	34983633
Polythelia Familial	Associate	34983633
Scott Bryant Graham syndrome	Associate	34983633, 36833176
Seizures	Associate	31784560, 34041744, 36833176, 40211296, 40317201
Status Epilepticus	Associate	34041744
Syndrome	Associate	35205321, 36833176
Triple Negative Breast Neoplasms	Associate	27276707
Vascular Diseases	Associate	35205321

CSNK2B (casein kinase 2 beta)