Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	146
Gene name Gene Name - the full gene name approved by the HGNC.	Adrenoceptor alpha 1D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADRA1D
Synonyms (NCBI Gene) Gene synonyms aliases	ADRA1, ADRA1A, ADRA1R, ALPHA1, DAR, dJ779E11.2
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20p13
Summary Summary of gene provided in NCBI Entrez Gene.	Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of whi

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments
MIRT769806	hsa-miR-1261	CLIP-seq
MIRT769807	hsa-miR-3120-3p	CLIP-seq
MIRT769808	hsa-miR-3184	CLIP-seq
MIRT769809	hsa-miR-423-5p	CLIP-seq
MIRT769810	hsa-miR-4263	CLIP-seq
MIRT769811	hsa-miR-4287	CLIP-seq
MIRT769812	hsa-miR-4469	CLIP-seq
MIRT769813	hsa-miR-4641	CLIP-seq
MIRT769814	hsa-miR-4685-3p	CLIP-seq
MIRT769815	hsa-miR-4779	CLIP-seq
MIRT769816	hsa-miR-490-5p	CLIP-seq
MIRT1927075	hsa-miR-4715-3p	CLIP-seq
MIRT2167979	hsa-miR-486-3p	CLIP-seq
MIRT2383975	hsa-miR-125a-3p	CLIP-seq
MIRT2383976	hsa-miR-4640-5p	CLIP-seq
MIRT2383977	hsa-miR-4726-5p	CLIP-seq
MIRT769808	hsa-miR-3184	CLIP-seq
MIRT769809	hsa-miR-423-5p	CLIP-seq
MIRT2443288	hsa-miR-4688	CLIP-seq
MIRT769815	hsa-miR-4779	CLIP-seq
MIRT2167979	hsa-miR-486-3p	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004935	Function	Adrenergic receptor activity	IEA
GO:0004937	Function	Alpha1-adrenergic receptor activity	IBA
GO:0004937	Function	Alpha1-adrenergic receptor activity	IEA
GO:0004937	Function	Alpha1-adrenergic receptor activity	TAS	10820200
GO:0005515	Function	Protein binding	IPI	16533813, 18468998, 21115837, 24550280, 26460884, 26617989, 27382054
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7746284
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	1656955
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	10820200
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007267	Process	Cell-cell signaling	IBA
GO:0007267	Process	Cell-cell signaling	TAS	1656955
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10860850
GO:0016020	Component	Membrane	IEA
GO:0042802	Function	Identical protein binding	IPI	14645668, 26617989, 27382054
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0045907	Process	Positive regulation of vasoconstriction	IBA
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA
GO:0150099	Process	Neuron-glial cell signaling	ISS

MIM	HGNC	e!Ensembl
104219	280	ENSG00000171873

Protein

UniProt ID

P25100

Protein name

Alpha-1D adrenergic receptor (Alpha-1A adrenergic receptor) (Alpha-1D adrenoreceptor) (Alpha-1D adrenoceptor) (Alpha-adrenergic receptor 1a)

Protein function

This alpha-adrenergic receptor mediates its effect through the influx of extracellular calcium.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	113 → 402	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
AVSLGVPHEVAEGATCQAYELADYSNLRETDI

Sequence length

572

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cGMP-PKG signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Adrenergic signaling in cardiomyocytes Vascular smooth muscle contraction Salivary secretion		Adrenoceptors G alpha (q) signalling events G alpha (12/13) signalling events

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Crohn Disease	Paneth cell defects in Crohn's disease	N/A	N/A	GWAS
Metabolic Syndrome	Serum polyunsaturated fatty acid concentration x Mediterranean diet adherence interaction in metabolic syndrome	N/A	N/A	GWAS
Preeclampsia	Preeclampsia	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	36776063
Coronary Disease	Associate	37679988
Dementia Vascular	Associate	36776063
Glioblastoma	Associate	33806345, 40184918
Glioma	Associate	40184918
Hypertension Pulmonary	Associate	24465776
Neoplasms	Associate	35537053
Obesity	Associate	24173768
Obesity Abdominal	Associate	24173768
Prostatic Neoplasms	Associate	25481381
Schizophrenia	Associate	26381449
Sexual Dysfunctions Psychological	Associate	26381449
Signs and Symptoms	Associate	26288143
Testicular Neoplasms	Associate	21299476

ADRA1D (adrenoceptor alpha 1D)