FAM81A (family with sequence similarity 81 member A)

Gene

• Entrez ID: 145773
• Gene name: Family with sequence similarity 81 member A
• Gene symbol: FAM81A
• Synonyms (NCBI Gene): -
• Chromosome: 15
• Chromosome location: 15q22.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019380	hsa-miR-148b-3p	Microarray	17612493
MIRT021765	hsa-miR-132-3p	Microarray	17612493
MIRT023709	hsa-miR-1-3p	Microarray	18668037
MIRT987461	hsa-miR-1207-3p	CLIP-seq
MIRT987462	hsa-miR-1271	CLIP-seq
MIRT987463	hsa-miR-138	CLIP-seq
MIRT987464	hsa-miR-199a-3p	CLIP-seq
MIRT987465	hsa-miR-199b-3p	CLIP-seq
MIRT987466	hsa-miR-3129-5p	CLIP-seq
MIRT987467	hsa-miR-3187-3p	CLIP-seq
MIRT987468	hsa-miR-3647-3p	CLIP-seq
MIRT987469	hsa-miR-3671	CLIP-seq
MIRT987470	hsa-miR-4267	CLIP-seq
MIRT987471	hsa-miR-4435	CLIP-seq
MIRT987472	hsa-miR-4694-5p	CLIP-seq
MIRT987473	hsa-miR-4701-5p	CLIP-seq
MIRT987474	hsa-miR-4711-5p	CLIP-seq
MIRT987475	hsa-miR-548ac	CLIP-seq
MIRT987476	hsa-miR-548ae	CLIP-seq
MIRT987477	hsa-miR-548aj	CLIP-seq
MIRT987478	hsa-miR-548am	CLIP-seq
MIRT987479	hsa-miR-548d-3p	CLIP-seq
MIRT987480	hsa-miR-548s	CLIP-seq
MIRT987481	hsa-miR-548x	CLIP-seq
MIRT987482	hsa-miR-548z	CLIP-seq
MIRT987483	hsa-miR-578	CLIP-seq
MIRT987484	hsa-miR-588	CLIP-seq
MIRT987485	hsa-miR-652	CLIP-seq
MIRT987486	hsa-miR-936	CLIP-seq
MIRT987487	hsa-miR-96	CLIP-seq
MIRT1992620	hsa-miR-1305	CLIP-seq
MIRT1992621	hsa-miR-3136-5p	CLIP-seq
MIRT1992622	hsa-miR-34a	CLIP-seq
MIRT1992623	hsa-miR-34c-5p	CLIP-seq
MIRT987469	hsa-miR-3671	CLIP-seq
MIRT1992624	hsa-miR-3908	CLIP-seq
MIRT1992625	hsa-miR-3942-5p	CLIP-seq
MIRT1992626	hsa-miR-4439	CLIP-seq
MIRT1992627	hsa-miR-449a	CLIP-seq
MIRT1992628	hsa-miR-449b	CLIP-seq
MIRT1992629	hsa-miR-4513	CLIP-seq
MIRT1992630	hsa-miR-4703-5p	CLIP-seq
MIRT1992631	hsa-miR-4717-3p	CLIP-seq
MIRT1992632	hsa-miR-4766-3p	CLIP-seq
MIRT1992620	hsa-miR-1305	CLIP-seq
MIRT1992621	hsa-miR-3136-5p	CLIP-seq
MIRT1992622	hsa-miR-34a	CLIP-seq
MIRT1992623	hsa-miR-34c-5p	CLIP-seq
MIRT1992624	hsa-miR-3908	CLIP-seq
MIRT1992625	hsa-miR-3942-5p	CLIP-seq
MIRT2226607	hsa-miR-421	CLIP-seq
MIRT1992626	hsa-miR-4439	CLIP-seq
MIRT1992627	hsa-miR-449a	CLIP-seq
MIRT1992628	hsa-miR-449b	CLIP-seq
MIRT1992629	hsa-miR-4513	CLIP-seq
MIRT2226608	hsa-miR-4662a-5p	CLIP-seq
MIRT1992630	hsa-miR-4703-5p	CLIP-seq
MIRT1992631	hsa-miR-4717-3p	CLIP-seq
MIRT2226609	hsa-miR-4761-5p	CLIP-seq
MIRT1992632	hsa-miR-4766-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IDA	31429579
GO:0005737	Component	Cytoplasm	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0045202	Component	Synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099092	Component	Postsynaptic density, intracellular component	IEA
GO:0140693	Function	Molecular condensate scaffold activity	IEA
GO:0140693	Function	Molecular condensate scaffold activity	ISS

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q8TBF8
• Protein name: Protein FAM81A
• Protein function: Facilitates the interaction and assembly of proteins within the postsynaptic density by promoting the condensation of postsynaptic proteins via liquid-liquid phase separation. Required for neuronal activity. Accumulation at the postsynaptic dens
• Sequence:

  MENMHLRRVRTMPRHSQSLTMAPYSSVSLVEQLEDRILCHEKTTAALVEHAFRIKDDIVN
  SLQKMQNKGGGDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKT
  LEMRQLSGLGDLRGRVARCDASIARLSAEHKTTYEGLQHLNKEQQAAKLILETKIKDAEG
  QISQLLNRVDLSISEQSTKLKMSHRDSNHQLQLLDTKFKGTVEELSNQILSARSWLQQEQ
  ERIEKELLQKIDQLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEE
  EKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSLRQVLEAKMKLDRDQLQKQIQL
  MQKPETPM

• Sequence length: 368

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIC-rearranged sarcoma	not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC INFLAMMATORY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations