Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	145581
Gene name Gene Name - the full gene name approved by the HGNC.	Leucine rich repeat and fibronectin type III domain containing 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LRFN5
Synonyms (NCBI Gene) Gene synonyms aliases	C14orf146, FIGLER8, SALM5
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q21.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that belongs to the leucine-rich repeat and fibronectin type III domain-containing family of proteins. A similar protein in mouse, a glycosylated transmembrane protein, is thought to function in presynaptic differentiation. [pr

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments
MIRT1117556	hsa-miR-4282	CLIP-seq
MIRT1117557	hsa-miR-4717-5p	CLIP-seq
MIRT2033201	hsa-miR-106a	CLIP-seq
MIRT2033202	hsa-miR-106b	CLIP-seq
MIRT2033203	hsa-miR-1193	CLIP-seq
MIRT2033204	hsa-miR-139-5p	CLIP-seq
MIRT2033205	hsa-miR-17	CLIP-seq
MIRT2033206	hsa-miR-20a	CLIP-seq
MIRT2033207	hsa-miR-20b	CLIP-seq
MIRT2033208	hsa-miR-2681	CLIP-seq
MIRT2033209	hsa-miR-3065-5p	CLIP-seq
MIRT2033210	hsa-miR-3609	CLIP-seq
MIRT2033211	hsa-miR-3689a-5p	CLIP-seq
MIRT2033212	hsa-miR-3689b	CLIP-seq
MIRT2033213	hsa-miR-3689e	CLIP-seq
MIRT2033214	hsa-miR-3689f	CLIP-seq
MIRT2033215	hsa-miR-421	CLIP-seq
MIRT2033216	hsa-miR-4272	CLIP-seq
MIRT1117556	hsa-miR-4282	CLIP-seq
MIRT2033217	hsa-miR-4426	CLIP-seq
MIRT2033218	hsa-miR-4647	CLIP-seq
MIRT2033219	hsa-miR-4659a-3p	CLIP-seq
MIRT2033220	hsa-miR-4659b-3p	CLIP-seq
MIRT2033221	hsa-miR-4662b	CLIP-seq
MIRT1117557	hsa-miR-4717-5p	CLIP-seq
MIRT2033222	hsa-miR-4796-3p	CLIP-seq
MIRT2033223	hsa-miR-490-5p	CLIP-seq
MIRT2033224	hsa-miR-5096	CLIP-seq
MIRT2033225	hsa-miR-519d	CLIP-seq
MIRT2033226	hsa-miR-548ah	CLIP-seq
MIRT2033227	hsa-miR-622	CLIP-seq
MIRT2033228	hsa-miR-659	CLIP-seq
MIRT2033229	hsa-miR-93	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	27152329
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0043031	Process	Negative regulation of macrophage activation	IEA
GO:0043031	Process	Negative regulation of macrophage activation	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IDA	27152329
GO:0098839	Component	Postsynaptic density membrane	IBA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IBA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099560	Process	Synaptic membrane adhesion	IBA
GO:0099560	Process	Synaptic membrane adhesion	IEA
GO:1905606	Process	Regulation of presynapse assembly	IBA
GO:1905606	Process	Regulation of presynapse assembly	IEA

MIM	HGNC	e!Ensembl
612811	20360	ENSG00000165379

Protein

UniProt ID

Q96NI6

Protein name

Leucine-rich repeat and fibronectin type-III domain-containing protein 5

Protein function

Cell adhesion molecule that mediates homophilic cell-cell adhesion in a Ca(2+)-independent manner. Promotes neurite outgrowth in hippocampal neurons.

PDB

5XNP , 5XNQ , 5XWS , 5XWT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13306	LRR_5	56 → 213	BspA type Leucine rich repeat region (6 copies)	Repeat
PF07679	I-set	287 → 374	Immunoglobulin I-set domain	Domain

Sequence

MEKILFYLFLIGIAVKAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLAD
NFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFS
GLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDH
NMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGN
PLHCNCELLWLRRLSREDDLETCASPPLLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLE
GQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGAFTCIAS
NPAGEATQIVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNTSSSNGDTKLSQDK
IVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPTSKTFLVNNLAAGT
MYDLCVLAIYDDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIVAS
VLVFIIILMIRYKVCNNNGQHKVTKVSNVYSQTNGAQIQGCSVTLPQSVSKQAVGHEENA
QCCKATSDNVIQSSETCSSQDSSTTTSALPPSWTSSTSVSQKQKRKTGTKPSTEPQNEAV
TNVESQNTNRNNSTALQLASRPPDSVTEGPTSKRAHIKPNALLTNVDQIVQETQRLELI

Sequence length

719

Interactions

View interactions

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Cervical Cancer	Cervical cancer	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Mental Depression	Major depressive disorder	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Myopia	Myopia	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Autism Spectrum Disorder	Associate	31152157
Mental Disorders	Associate	31152157
Stomach Neoplasms	Associate	35578189

LRFN5 (leucine rich repeat and fibronectin type III domain containing 5)