Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1455
Gene name	Casein kinase 1 gamma 2
Gene symbol	CSNK1G2
Synonyms (NCBI Gene)	CK1g2
Chromosome	19
Chromosome location	19p13.3

122

Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026979	hsa-miR-107	Microarray	20489155
MIRT028634	hsa-miR-30a-5p	Proteomics	18668040
MIRT650076	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT650075	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT650074	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT650073	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT650072	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT650071	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT650070	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT199844	hsa-miR-155-5p	PAR-CLIP	22291592
MIRT199847	hsa-miR-3121-3p	PAR-CLIP	22291592
MIRT498174	hsa-miR-6768-5p	PAR-CLIP	22291592
MIRT498173	hsa-miR-4759	PAR-CLIP	22291592
MIRT498172	hsa-miR-4305	PAR-CLIP	22291592
MIRT199845	hsa-miR-432-5p	PAR-CLIP	22291592
MIRT498171	hsa-miR-6503-3p	PAR-CLIP	22291592
MIRT498170	hsa-miR-7154-3p	PAR-CLIP	22291592
MIRT498169	hsa-miR-1249-5p	PAR-CLIP	22291592
MIRT498168	hsa-miR-6797-5p	PAR-CLIP	22291592
MIRT199852	hsa-miR-7106-5p	PAR-CLIP	22291592
MIRT199851	hsa-miR-6825-5p	PAR-CLIP	22291592
MIRT199846	hsa-miR-569	PAR-CLIP	22291592
MIRT498167	hsa-miR-4443	PAR-CLIP	22291592
MIRT199849	hsa-miR-6515-5p	PAR-CLIP	22291592
MIRT650076	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT650075	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT650074	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT650073	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT650072	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT650071	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT650070	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT199844	hsa-miR-155-5p	PAR-CLIP	22291592
MIRT199847	hsa-miR-3121-3p	PAR-CLIP	22291592
MIRT498174	hsa-miR-6768-5p	PAR-CLIP	22291592
MIRT498173	hsa-miR-4759	PAR-CLIP	22291592
MIRT498172	hsa-miR-4305	PAR-CLIP	22291592
MIRT199845	hsa-miR-432-5p	PAR-CLIP	22291592
MIRT498171	hsa-miR-6503-3p	PAR-CLIP	22291592
MIRT498170	hsa-miR-7154-3p	PAR-CLIP	22291592
MIRT498169	hsa-miR-1249-5p	PAR-CLIP	22291592
MIRT498168	hsa-miR-6797-5p	PAR-CLIP	22291592
MIRT199852	hsa-miR-7106-5p	PAR-CLIP	22291592
MIRT199851	hsa-miR-6825-5p	PAR-CLIP	22291592
MIRT199846	hsa-miR-569	PAR-CLIP	22291592
MIRT498167	hsa-miR-4443	PAR-CLIP	22291592
MIRT199849	hsa-miR-6515-5p	PAR-CLIP	22291592
MIRT912675	hsa-miR-103a	CLIP-seq
MIRT912676	hsa-miR-1182	CLIP-seq
MIRT912677	hsa-miR-1184	CLIP-seq
MIRT912678	hsa-miR-1291	CLIP-seq
MIRT912679	hsa-miR-149	CLIP-seq
MIRT912680	hsa-miR-2115	CLIP-seq
MIRT912681	hsa-miR-3064-5p	CLIP-seq
MIRT912682	hsa-miR-3151	CLIP-seq
MIRT912683	hsa-miR-3176	CLIP-seq
MIRT912684	hsa-miR-328	CLIP-seq
MIRT912685	hsa-miR-3614-5p	CLIP-seq
MIRT912686	hsa-miR-3686	CLIP-seq
MIRT912687	hsa-miR-3919	CLIP-seq
MIRT912688	hsa-miR-3922-3p	CLIP-seq
MIRT912689	hsa-miR-4292	CLIP-seq
MIRT912690	hsa-miR-4418	CLIP-seq
MIRT912691	hsa-miR-4422	CLIP-seq
MIRT912692	hsa-miR-4505	CLIP-seq
MIRT912693	hsa-miR-4520a-5p	CLIP-seq
MIRT912694	hsa-miR-4520b-5p	CLIP-seq
MIRT912695	hsa-miR-4646-5p	CLIP-seq
MIRT912696	hsa-miR-4651	CLIP-seq
MIRT912697	hsa-miR-4652-3p	CLIP-seq
MIRT912698	hsa-miR-4711-5p	CLIP-seq
MIRT912699	hsa-miR-4747-5p	CLIP-seq
MIRT912700	hsa-miR-4755-3p	CLIP-seq
MIRT912701	hsa-miR-4756-3p	CLIP-seq
MIRT912702	hsa-miR-4794	CLIP-seq
MIRT912703	hsa-miR-509-3-5p	CLIP-seq
MIRT912704	hsa-miR-509-5p	CLIP-seq
MIRT912705	hsa-miR-548ae	CLIP-seq
MIRT912706	hsa-miR-548aj	CLIP-seq
MIRT912707	hsa-miR-548am	CLIP-seq
MIRT912708	hsa-miR-548p	CLIP-seq
MIRT912709	hsa-miR-548x	CLIP-seq
MIRT912710	hsa-miR-608	CLIP-seq
MIRT912711	hsa-miR-622	CLIP-seq
MIRT912675	hsa-miR-103a	CLIP-seq
MIRT912676	hsa-miR-1182	CLIP-seq
MIRT912679	hsa-miR-149	CLIP-seq
MIRT1970642	hsa-miR-155	CLIP-seq
MIRT912680	hsa-miR-2115	CLIP-seq
MIRT912681	hsa-miR-3064-5p	CLIP-seq
MIRT1970643	hsa-miR-3065-3p	CLIP-seq
MIRT912683	hsa-miR-3176	CLIP-seq
MIRT912685	hsa-miR-3614-5p	CLIP-seq
MIRT912686	hsa-miR-3686	CLIP-seq
MIRT912688	hsa-miR-3922-3p	CLIP-seq
MIRT1970644	hsa-miR-432	CLIP-seq
MIRT1970645	hsa-miR-4645-5p	CLIP-seq
MIRT912697	hsa-miR-4652-3p	CLIP-seq
MIRT1970646	hsa-miR-4673	CLIP-seq
MIRT912702	hsa-miR-4794	CLIP-seq
MIRT1970647	hsa-miR-502-5p	CLIP-seq
MIRT912675	hsa-miR-103a	CLIP-seq
MIRT2206495	hsa-miR-3177-3p	CLIP-seq
MIRT2206496	hsa-miR-3186-3p	CLIP-seq
MIRT912685	hsa-miR-3614-5p	CLIP-seq
MIRT912686	hsa-miR-3686	CLIP-seq
MIRT912687	hsa-miR-3919	CLIP-seq
MIRT2206497	hsa-miR-4290	CLIP-seq
MIRT912689	hsa-miR-4292	CLIP-seq
MIRT2206498	hsa-miR-4485	CLIP-seq
MIRT912697	hsa-miR-4652-3p	CLIP-seq
MIRT2206499	hsa-miR-4707-3p	CLIP-seq
MIRT912698	hsa-miR-4711-5p	CLIP-seq
MIRT912701	hsa-miR-4756-3p	CLIP-seq
MIRT2206500	hsa-miR-4758-3p	CLIP-seq
MIRT2206501	hsa-miR-564	CLIP-seq
MIRT2436483	hsa-miR-1285	CLIP-seq
MIRT2206495	hsa-miR-3177-3p	CLIP-seq
MIRT2436484	hsa-miR-3187-5p	CLIP-seq
MIRT912689	hsa-miR-4292	CLIP-seq
MIRT2436485	hsa-miR-4691-3p	CLIP-seq
MIRT2206501	hsa-miR-564	CLIP-seq
MIRT2436486	hsa-miR-612	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	25500533
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	9403068
GO:0005515	Function	Protein binding	IPI	15917222, 16189514, 25416956, 28514442, 32296183, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005938	Component	Cell cortex	IEA
GO:0006468	Process	Protein phosphorylation	TAS	9403068
GO:0006897	Process	Endocytosis	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	TAS	9403068
GO:0016020	Component	Membrane	HDA	19946888
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030148	Process	Sphingolipid biosynthetic process	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IBA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
602214	2455	ENSG00000133275

P78368

Protein name

Casein kinase I isoform gamma-2 (CKI-gamma 2) (EC 2.7.11.1)

Protein function

Serine/threonine-protein kinase. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling (By simi

PDB

2C47

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	46 → 299	Protein kinase domain	Domain
PF12605	CK1gamma_C	356 → 385	Casein kinase 1 gamma C terminal	Family

Tissue specificity

TISSUE SPECIFICITY: Testis. {ECO:0000269|PubMed:9403068}.

Sequence

MDFDKKGGKGETEEGRRMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKR
QHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSK
NQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK

Sequence length

415

Interactions

View interactions

	KEGG		Reactome
	Hedgehog signaling pathway		Sphingolipid de novo biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenoma	Associate	17660800	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Papillary Follicular	Associate	17660800	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	37975370	★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular Cyst	Associate	17660800	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	17660800	★★★★★ ★☆☆☆☆ Found in Text Mining only

CSNK1G2 (casein kinase 1 gamma 2)