Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1447
Gene name Gene Name - the full gene name approved by the HGNC.
Casein beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CSN2
Synonyms (NCBI Gene) Gene synonyms aliases
CASB, PDC213
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the beta casein family. There are two types of casein protein, beta (encoded by this gene) and kappa, both of which are secreted in human milk. Beta casein is the principal protein in human milk and the primary source of essential
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT912029 hsa-miR-3646 CLIP-seq
MIRT912030 hsa-miR-3671 CLIP-seq
MIRT912031 hsa-miR-607 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
STAT5A Unknown 15746097;16832345
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004857 Function Enzyme inhibitor activity TAS 2387396
GO:0004869 Function Cysteine-type endopeptidase inhibitor activity IDA 12788072
GO:0005509 Function Calcium ion binding TAS 2387396
GO:0005515 Function Protein binding IPI 31515488, 32296183
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
115460 2447 ENSG00000135222
Protein
UniProt ID P05814
Protein name Beta-casein
Protein function Important role in determination of the surface properties of the casein micelles.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00363 Casein 129 210 Casein Family
Tissue specificity TISSUE SPECIFICITY: Mammary gland specific. Secreted in milk.
Sequence
MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQ
PQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKS
PTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIP
QQVVPYPQRAVPVQALLLNQELLLNPTHQI
YPVTQPLAPVHNPISV
Sequence length 226
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Prolactin signaling pathway   Nuclear signaling by ERBB4
<