CSN2 (casein beta)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 1447
Gene name Casein beta
Gene symbol CSN2
Synonyms (NCBI Gene)
CASBPDC213
Chromosome 4
Chromosome location 4q13.3
Summary This gene is a member of the beta casein family. There are two types of casein protein, beta (encoded by this gene) and kappa, both of which are secreted in human milk. Beta casein is the principal protein in human milk and the primary source of essential
miRNA miRNA information provided by mirtarbase database.
3
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (3)
miRTarBase ID miRNA Experiments Reference
MIRT912029 hsa-miR-3646 CLIP-seq
MIRT912030 hsa-miR-3671 CLIP-seq
MIRT912031 hsa-miR-607 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (1)
Transcription factor Regulation Reference
STAT5A Unknown 15746097;16832345
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (11)
GO ID Ontology Definition Evidence Reference
GO:0004857 Function Enzyme inhibitor activity TAS 2387396
GO:0004869 Function Cysteine-type endopeptidase inhibitor activity IDA 12788072
GO:0005509 Function Calcium ion binding TAS 2387396
GO:0005515 Function Protein binding IPI 31515488, 32296183
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
115460 2447 ENSG00000135222
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P05814
Protein name Beta-casein
Protein function Important role in determination of the surface properties of the casein micelles.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00363 Casein 129 → 210 Casein Family
Tissue specificity TISSUE SPECIFICITY: Mammary gland specific. Secreted in milk.
Sequence 
MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQ
PQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKS
PTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIP
QQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
Sequence length 226
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Prolactin signaling pathway   Nuclear signaling by ERBB4