Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	1445
Gene name	C-terminal Src kinase
Gene symbol	CSK
Synonyms (NCBI Gene)	-
Chromosome	15
Chromosome location	15q24.1
Summary	The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its association with the protein encoded by the protein tyrosine phosphatase, non-re

Show/Hide all (74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003960	hsa-miR-140-5p	Microarray	17875710
MIRT030606	hsa-miR-24-3p	Microarray	19748357
MIRT035928	hsa-miR-1180-3p	CLASH	23622248
MIRT755804	hsa-miR-192-3p	Luciferase reporter assayWestern blottingqRT-PCRRNA pull down assay	36914869
MIRT911892	hsa-miR-1225-5p	CLIP-seq
MIRT911893	hsa-miR-1302	CLIP-seq
MIRT911894	hsa-miR-130a	CLIP-seq
MIRT911895	hsa-miR-130b	CLIP-seq
MIRT911896	hsa-miR-148a	CLIP-seq
MIRT911897	hsa-miR-148b	CLIP-seq
MIRT911898	hsa-miR-151-5p	CLIP-seq
MIRT911899	hsa-miR-151b	CLIP-seq
MIRT911900	hsa-miR-152	CLIP-seq
MIRT911901	hsa-miR-2110	CLIP-seq
MIRT911902	hsa-miR-2467-5p	CLIP-seq
MIRT911903	hsa-miR-301a	CLIP-seq
MIRT911904	hsa-miR-301b	CLIP-seq
MIRT911905	hsa-miR-3150b-3p	CLIP-seq
MIRT911906	hsa-miR-3188	CLIP-seq
MIRT911907	hsa-miR-342-3p	CLIP-seq
MIRT911908	hsa-miR-346	CLIP-seq
MIRT911909	hsa-miR-365	CLIP-seq
MIRT911910	hsa-miR-3656	CLIP-seq
MIRT911911	hsa-miR-3660	CLIP-seq
MIRT911912	hsa-miR-3662	CLIP-seq
MIRT911913	hsa-miR-3666	CLIP-seq
MIRT911914	hsa-miR-3682-5p	CLIP-seq
MIRT911915	hsa-miR-3975	CLIP-seq
MIRT911916	hsa-miR-4271	CLIP-seq
MIRT911917	hsa-miR-4279	CLIP-seq
MIRT911918	hsa-miR-4295	CLIP-seq
MIRT911919	hsa-miR-4298	CLIP-seq
MIRT911920	hsa-miR-4457	CLIP-seq
MIRT911921	hsa-miR-4462	CLIP-seq
MIRT911922	hsa-miR-4526	CLIP-seq
MIRT911923	hsa-miR-454	CLIP-seq
MIRT911924	hsa-miR-4641	CLIP-seq
MIRT911925	hsa-miR-4725-3p	CLIP-seq
MIRT911926	hsa-miR-4731-5p	CLIP-seq
MIRT911927	hsa-miR-4732-3p	CLIP-seq
MIRT911928	hsa-miR-4750	CLIP-seq
MIRT911929	hsa-miR-4784	CLIP-seq
MIRT911930	hsa-miR-485-5p	CLIP-seq
MIRT911931	hsa-miR-513b	CLIP-seq
MIRT911932	hsa-miR-541	CLIP-seq
MIRT911933	hsa-miR-578	CLIP-seq
MIRT911934	hsa-miR-602	CLIP-seq
MIRT911935	hsa-miR-643	CLIP-seq
MIRT911936	hsa-miR-885-3p	CLIP-seq
MIRT911894	hsa-miR-130a	CLIP-seq
MIRT911895	hsa-miR-130b	CLIP-seq
MIRT911896	hsa-miR-148a	CLIP-seq
MIRT911897	hsa-miR-148b	CLIP-seq
MIRT911898	hsa-miR-151-5p	CLIP-seq
MIRT911899	hsa-miR-151b	CLIP-seq
MIRT911900	hsa-miR-152	CLIP-seq
MIRT911903	hsa-miR-301a	CLIP-seq
MIRT911904	hsa-miR-301b	CLIP-seq
MIRT911905	hsa-miR-3150b-3p	CLIP-seq
MIRT911937	hsa-miR-342-5p	CLIP-seq
MIRT911913	hsa-miR-3666	CLIP-seq
MIRT911918	hsa-miR-4295	CLIP-seq
MIRT911921	hsa-miR-4462	CLIP-seq
MIRT911923	hsa-miR-454	CLIP-seq
MIRT911938	hsa-miR-4664-5p	CLIP-seq
MIRT911929	hsa-miR-4784	CLIP-seq
MIRT911934	hsa-miR-602	CLIP-seq
MIRT1970311	hsa-miR-4417	CLIP-seq
MIRT1970312	hsa-miR-4437	CLIP-seq
MIRT911932	hsa-miR-541	CLIP-seq
MIRT911932	hsa-miR-541	CLIP-seq
MIRT911924	hsa-miR-4641	CLIP-seq
MIRT2509566	hsa-miR-4758-3p	CLIP-seq
MIRT2509567	hsa-miR-552	CLIP-seq

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002682	Process	Regulation of immune system process	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS	1945408
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	7507203, 10026153, 10790433, 12446738, 14665621, 15683240, 16354697, 17911601, 18070987, 18614016, 19167335, 21930792, 24902122, 28514442, 31980649, 32296183, 32707033, 33961781
GO:0005515	Function	Protein binding	TAS	8890164
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	8890164
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IPI	10790433
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IEA
GO:0006468	Process	Protein phosphorylation	TAS	1945408
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010989	Process	Negative regulation of low-density lipoprotein particle clearance	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0031295	Process	T cell costimulation	TAS
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0034236	Function	Protein kinase A catalytic subunit binding	IPI	17911601
GO:0034332	Process	Adherens junction organization	IBA
GO:0034332	Process	Adherens junction organization	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042802	Function	Identical protein binding	IPI	19888460
GO:0042997	Process	Negative regulation of Golgi to plasma membrane protein transport	IDA	20605918
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0050765	Process	Negative regulation of phagocytosis	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0060368	Process	Regulation of Fc receptor mediated stimulatory signaling pathway	IBA
GO:0060368	Process	Regulation of Fc receptor mediated stimulatory signaling pathway	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070064	Function	Proline-rich region binding	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IEA

MIM	HGNC	e!Ensembl
124095	2444	ENSG00000103653

P41240

Protein name

Tyrosine-protein kinase CSK (EC 2.7.10.2) (C-Src kinase) (Protein-tyrosine kinase CYL)

Protein function

Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) inc

PDB

1BYG , 1CSK , 3D7T , 3D7U , 3EAC , 3EAZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	15 → 62	SH3 domain	Domain
PF00017	SH2	82 → 156	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	195 → 440	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung and macrophages. {ECO:0000269|PubMed:1371489}.

Sequence

MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL

Sequence length

450

Interactions

View interactions

	KEGG		Reactome
	Epithelial cell signaling in Helicobacter pylori infection		GAB1 signalosome Phosphorylation of CD3 and TCR zeta chains Integrin signaling PD-1 signaling MAP2K and MAPK activation Signaling by moderate kinase activity BRAF mutants Signaling by high-kinase activity BRAF mutants Signaling by BRAF and RAF fusions Paradoxical activation of RAF signaling by kinase inactive BRAF Signaling downstream of RAS mutants

CSK (C-terminal Src kinase)