CSHL1 (chorionic somatomammotropin hormone like 1)

Gene

• Entrez ID: 1444
• Gene name: Chorionic somatomammotropin hormone like 1
• Gene symbol: CSHL1
• Synonyms (NCBI Gene): CS-5, CSHP1, CSL, GHB4, hCS-L
• Chromosome: 17
• Chromosome location: 17q23.3
• Summary: The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002476	hsa-miR-16-5p	proteomics analysis	18362358
MIRT911882	hsa-miR-3150a-3p	CLIP-seq
MIRT911883	hsa-miR-3175	CLIP-seq
MIRT911884	hsa-miR-4640-5p	CLIP-seq
MIRT911885	hsa-miR-4667-5p	CLIP-seq
MIRT911886	hsa-miR-4700-5p	CLIP-seq
MIRT911887	hsa-miR-4726-5p	CLIP-seq
MIRT911888	hsa-miR-4728-5p	CLIP-seq
MIRT911889	hsa-miR-4768-3p	CLIP-seq
MIRT911890	hsa-miR-665	CLIP-seq
MIRT911891	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005131	Function	Growth hormone receptor binding	IBA
GO:0005131	Function	Growth hormone receptor binding	IEA
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	NAS	2744760
GO:0005515	Function	Protein binding	IPI	35156780
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0012505	Component	Endomembrane system	IEA
GO:0031667	Process	Response to nutrient levels	IBA
GO:0031982	Component	Vesicle	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048513	Process	Animal organ development	IBA
GO:0060396	Process	Growth hormone receptor signaling pathway	IBA

Other IDs

• MIM: 603515
• HGNC: 2442
• e!Ensembl: ENSG00000204414

Protein

• UniProt ID: Q14406
• Protein name: Chorionic somatomammotropin hormone-like 1 (Chorionic somatomammotropin-like) (Lactogen-like)
• Protein function: May be a novel gestational hormone required to compensate for absence of other members of the GH/CS cluster during gestation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00103	Hormone_1	9 → 220	Somatotropin hormone family	Domain

• Sequence:

  MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISS
  WGMEAYITKEQKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLELLHISLLLIESRLEP
  VRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTN
  SHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF

• Sequence length: 222

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Hormone signaling
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
Growth hormone synthesis, secretion and action