Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1444
Gene name Gene Name - the full gene name approved by the HGNC.	Chorionic somatomammotropin hormone like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CSHL1
Synonyms (NCBI Gene) Gene synonyms aliases	CS-5, CSHP1, CSL, GHB4, hCS-L
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they

Show/Hide all(11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002476	hsa-miR-16-5p	proteomics analysis	18362358
MIRT911882	hsa-miR-3150a-3p	CLIP-seq
MIRT911883	hsa-miR-3175	CLIP-seq
MIRT911884	hsa-miR-4640-5p	CLIP-seq
MIRT911885	hsa-miR-4667-5p	CLIP-seq
MIRT911886	hsa-miR-4700-5p	CLIP-seq
MIRT911887	hsa-miR-4726-5p	CLIP-seq
MIRT911888	hsa-miR-4728-5p	CLIP-seq
MIRT911889	hsa-miR-4768-3p	CLIP-seq
MIRT911890	hsa-miR-665	CLIP-seq
MIRT911891	hsa-miR-939	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005131	Function	Growth hormone receptor binding	IBA	21873635
GO:0005179	Function	Hormone activity	IBA	21873635
GO:0005179	Function	Hormone activity	NAS	2744760
GO:0005575	Component	Cellular_component	ND
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008150	Process	Biological_process	ND
GO:0031667	Process	Response to nutrient levels	IBA	21873635
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IBA	21873635
GO:0045927	Process	Positive regulation of growth	IBA	21873635
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:0048513	Process	Animal organ development	IBA	21873635
GO:0060396	Process	Growth hormone receptor signaling pathway	IBA	21873635

MIM	HGNC	e!Ensembl
603515	2442	ENSG00000204414

Protein

UniProt ID

Q14406

Protein name

Chorionic somatomammotropin hormone-like 1 (Chorionic somatomammotropin-like) (Lactogen-like)

Protein function

May be a novel gestational hormone required to compensate for absence of other members of the GH/CS cluster during gestation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00103	Hormone_1	9 → 220	Somatotropin hormone family	Domain

Sequence

MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISS
WGMEAYITKEQKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLELLHISLLLIESRLEP
VRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTN
SHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF

Sequence length

222

Interactions

View interactions

	KEGG
	Cytokine-cytokine receptor interaction Neuroactive ligand-receptor interaction Hormone signaling PI3K-Akt signaling pathway JAK-STAT signaling pathway Growth hormone synthesis, secretion and action

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID
Causal
Isolated growth hormone deficiency	Isolated Growth Hormone Deficiency, Type II, ISOLATED GROWTH HORMONE DEFICIENCY, TYPE IV	rs797044449, rs863223308, rs121918117, rs2302022, rs121918118, rs121918119, rs121918120, rs121918121, rs2128596101, rs483352872, rs200848306, rs606231412, rs606231413, rs779187338, rs370930012, rs918108896, rs1562606449 View all (2 more)
Kowarski syndrome	Kowarski syndrome	rs137853220, rs137853221, rs137853222

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Neoplasms	Associate	27163456
Ovarian Neoplasms	Associate	18974129
Pancreatic Neoplasms	Associate	34134622

CSHL1 (chorionic somatomammotropin hormone like 1)