RFLNA (refilin A)

Gene

• Entrez ID: 144347
• Gene name: Refilin A
• Gene symbol: RFLNA
• Synonyms (NCBI Gene): CFM2, FAM101A
• Chromosome: 12
• Chromosome location: 12q24.31

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0031005	Function	Filamin binding	IBA
GO:0031005	Function	Filamin binding	IEA
GO:0032432	Component	Actin filament bundle	IBA
GO:0032432	Component	Actin filament bundle	IEA
GO:0048705	Process	Skeletal system morphogenesis	IBA
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:0061181	Process	Regulation of chondrocyte development	IEA
GO:0061182	Process	Negative regulation of chondrocyte development	IBA
GO:0061182	Process	Negative regulation of chondrocyte development	IEA
GO:0061572	Process	Actin filament bundle organization	IBA
GO:0061572	Process	Actin filament bundle organization	IEA
GO:0061572	Process	Actin filament bundle organization	IEA
GO:1900158	Process	Negative regulation of bone mineralization involved in bone maturation	IBA
GO:1900158	Process	Negative regulation of bone mineralization involved in bone maturation	IEA

Other IDs

• MIM: 615927
• HGNC: 27051
• e!Ensembl: ENSG00000178882

Protein

• UniProt ID: Q6ZTI6
• Protein name: Refilin-A (Regulator of filamin protein A) (RefilinA)
• Protein function: Involved in the regulation of the perinuclear actin network and nuclear shape through interaction with filamins. Plays an essential role in actin cytoskeleton formation in developing cartilaginous cells.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15068	FAM101	1 → 203	FAM101 family	Family

• Sequence:

  MVGHLHLQGMEDSLKEQGREGLLDSPDSGLPPSPSPSPPFYSLAPGILDARAGGAGASSE
  PPGPSEARAPPSQLPNPPASEMRPRMLPVFFGESIKVNPEPTHEIRCNSEVKYASEKHFQ
  DKVFYAPVPTVTAYSETIVAAPNCTWRNYRSQLTLEPRPRALRFRSTTIIFPKHARSTFR
  TTLHCSLGRPSRWFTASVQLQLCQDPAPSLLGPATL

• Sequence length: 216