Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1442
Gene name Gene Name - the full gene name approved by the HGNC.	Chorionic somatomammotropin hormone 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CSH1
Synonyms (NCBI Gene) Gene synonyms aliases	CS-1, CSA, CSMT, GHB3, PL, hCS-1, hCS-A
Disease Acronyms (UniProt) Disease acronyms from UniProt database	CSA
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same t

Show/Hide all(10)

miRTarBase ID	miRNA	Experiments
MIRT911862	hsa-miR-3150a-3p	CLIP-seq
MIRT911863	hsa-miR-3175	CLIP-seq
MIRT911864	hsa-miR-4640-5p	CLIP-seq
MIRT911865	hsa-miR-4667-5p	CLIP-seq
MIRT911866	hsa-miR-4700-5p	CLIP-seq
MIRT911867	hsa-miR-4726-5p	CLIP-seq
MIRT911868	hsa-miR-4728-5p	CLIP-seq
MIRT911869	hsa-miR-4768-3p	CLIP-seq
MIRT911870	hsa-miR-665	CLIP-seq
MIRT911871	hsa-miR-939	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
CEBPB	Unknown	10855690
NFIC	Unknown	10715552
TFAP2A	Unknown	10715552

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005131	Function	Growth hormone receptor binding	IBA	21873635
GO:0005179	Function	Hormone activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	25009770, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005783	Component	Endoplasmic reticulum	IDA	6930851
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0031667	Process	Response to nutrient levels	IBA	21873635
GO:0031904	Component	Endosome lumen	TAS
GO:0031982	Component	Vesicle	IDA	6930851
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IBA	21873635
GO:0045927	Process	Positive regulation of growth	IBA	21873635
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:0048513	Process	Animal organ development	IBA	21873635
GO:0060396	Process	Growth hormone receptor signaling pathway	IBA	21873635
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	TAS

MIM	HGNC	e!Ensembl
150200	2440	ENSG00000136488

Protein

UniProt ID

P0DML2

Protein name

Chorionic somatomammotropin hormone 1 (Choriomammotropin) (Lactogen) (Placental lactogen) (PL)

Protein function

Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.

PDB

1Z7C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00103	Hormone_1	9 → 215	Somatotropin hormone family	Domain

Sequence

MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Sequence length

217

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Neuroactive ligand-receptor interaction Hormone signaling PI3K-Akt signaling pathway JAK-STAT signaling pathway Growth hormone synthesis, secretion and action		Prolactin receptor signaling Growth hormone receptor signaling

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Diabetes	Diabetes			GWAS

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	21280075, 23595767, 36697254
Breast Neoplasms	Associate	19047151, 24475273
Carotid Stenosis	Associate	17622311
Chondrosarcoma	Associate	19742314
Cockayne Syndrome	Associate	12060667, 12655141, 29225035, 30009828, 30504782, 31980658, 37216802
Colorectal Neoplasms	Associate	36389763
Dermatitis Allergic Contact	Associate	12167174
Dermatitis Contact	Stimulate	12167174
Glioma	Associate	40640380
Hereditary leiomyomatosis and renal cell cancer	Associate	27789281
Hypoxia Brain	Inhibit	24126540
Lupus Erythematosus Systemic	Associate	8254055
Lymphoma	Associate	36402300
Melanoma	Associate	1530947, 16405722, 2137460, 9488735
Multiple Myeloma	Associate	11154207, 32385241
Ovarian Neoplasms	Associate	26084610
Pre Eclampsia	Associate	22387044
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	12899713
Seminoma	Associate	34341387
Silver Russell Syndrome	Associate	9733042
Squamous Cell Carcinoma of Head and Neck	Associate	20579373
Triple Negative Breast Neoplasms	Inhibit	35429924
Vasculitis	Associate	8254055

CSH1 (chorionic somatomammotropin hormone 1)