CSH1 (chorionic somatomammotropin hormone 1)

Gene

• Entrez ID: 1442
• Gene name: Chorionic somatomammotropin hormone 1
• Gene symbol: CSH1
• Synonyms (NCBI Gene): CS-1, CSA, CSMT, GHB3, PL, hCS-1, hCS-A
• Chromosome: 17
• Chromosome location: 17q23.3
• Summary: The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT911862	hsa-miR-3150a-3p	CLIP-seq
MIRT911863	hsa-miR-3175	CLIP-seq
MIRT911864	hsa-miR-4640-5p	CLIP-seq
MIRT911865	hsa-miR-4667-5p	CLIP-seq
MIRT911866	hsa-miR-4700-5p	CLIP-seq
MIRT911867	hsa-miR-4726-5p	CLIP-seq
MIRT911868	hsa-miR-4728-5p	CLIP-seq
MIRT911869	hsa-miR-4768-3p	CLIP-seq
MIRT911870	hsa-miR-665	CLIP-seq
MIRT911871	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPB	Unknown	10855690
NFIC	Unknown	10715552
TFAP2A	Unknown	10715552

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005131	Function	Growth hormone receptor binding	IBA
GO:0005131	Function	Growth hormone receptor binding	IEA
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	25009770, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	6930851
GO:0008083	Function	Growth factor activity	IBA
GO:0012505	Component	Endomembrane system	IEA
GO:0031667	Process	Response to nutrient levels	IBA
GO:0031904	Component	Endosome lumen	TAS
GO:0031982	Component	Vesicle	IDA	6930851
GO:0031982	Component	Vesicle	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048513	Process	Animal organ development	IBA
GO:0060396	Process	Growth hormone receptor signaling pathway	IBA

Other IDs

• MIM: 150200
• HGNC: 2440
• e!Ensembl: ENSG00000136488

Protein

• UniProt ID: P0DML2
• Protein name: Chorionic somatomammotropin hormone 1 (Choriomammotropin) (Lactogen) (Placental lactogen) (PL)
• Protein function: Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
• PDB: 1Z7C
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00103	Hormone_1	9 → 215	Somatotropin hormone family	Domain

• Sequence:

  MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
  YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
  SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
  ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

• Sequence length: 217

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Hormone signaling
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
Growth hormone synthesis, secretion and action

Reactome:

Prolactin receptor signaling
Growth hormone receptor signaling