Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	1440
Gene name	Colony stimulating factor 3
Gene symbol	CSF3
Synonyms (NCBI Gene)	C17orf33CSF3OSGCSF
Chromosome	17
Chromosome location	17q21.1
Summary	This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modifi

Show/Hide all (89)

miRTarBase ID	miRNA	Experiments
MIRT911805	hsa-miR-1254	CLIP-seq
MIRT911806	hsa-miR-1291	CLIP-seq
MIRT911807	hsa-miR-198	CLIP-seq
MIRT911808	hsa-miR-3116	CLIP-seq
MIRT911809	hsa-miR-328	CLIP-seq
MIRT911810	hsa-miR-4269	CLIP-seq
MIRT911811	hsa-miR-4645-5p	CLIP-seq
MIRT911812	hsa-miR-4673	CLIP-seq
MIRT911813	hsa-miR-661	CLIP-seq
MIRT911814	hsa-miR-1197	CLIP-seq
MIRT911815	hsa-miR-1909	CLIP-seq
MIRT911816	hsa-miR-4533	CLIP-seq
MIRT911817	hsa-miR-4747-5p	CLIP-seq
MIRT2447721	hsa-miR-1470	CLIP-seq
MIRT2447722	hsa-miR-188-3p	CLIP-seq
MIRT2447723	hsa-miR-2355-5p	CLIP-seq
MIRT2447724	hsa-miR-4469	CLIP-seq
MIRT2447725	hsa-miR-4667-3p	CLIP-seq
MIRT2447726	hsa-miR-532-3p	CLIP-seq
MIRT2509457	hsa-miR-1207-5p	CLIP-seq
MIRT2509458	hsa-miR-1236	CLIP-seq
MIRT2509459	hsa-miR-1264	CLIP-seq
MIRT2509460	hsa-miR-139-3p	CLIP-seq
MIRT2509461	hsa-miR-1825	CLIP-seq
MIRT2509462	hsa-miR-1912	CLIP-seq
MIRT2509463	hsa-miR-1915	CLIP-seq
MIRT2447723	hsa-miR-2355-5p	CLIP-seq
MIRT2509464	hsa-miR-2467-3p	CLIP-seq
MIRT2509465	hsa-miR-2467-5p	CLIP-seq
MIRT2509466	hsa-miR-3121-3p	CLIP-seq
MIRT2509467	hsa-miR-3144-5p	CLIP-seq
MIRT2509468	hsa-miR-3150a-3p	CLIP-seq
MIRT2509469	hsa-miR-3175	CLIP-seq
MIRT2509470	hsa-miR-3188	CLIP-seq
MIRT2509471	hsa-miR-3191	CLIP-seq
MIRT2509472	hsa-miR-339-5p	CLIP-seq
MIRT2509473	hsa-miR-3653	CLIP-seq
MIRT2509474	hsa-miR-3657	CLIP-seq
MIRT2509475	hsa-miR-3658	CLIP-seq
MIRT2509476	hsa-miR-3664-3p	CLIP-seq
MIRT2509477	hsa-miR-3665	CLIP-seq
MIRT2509478	hsa-miR-3677-3p	CLIP-seq
MIRT2509479	hsa-miR-3678-3p	CLIP-seq
MIRT2509480	hsa-miR-371b-3p	CLIP-seq
MIRT2509481	hsa-miR-3934	CLIP-seq
MIRT2509482	hsa-miR-3975	CLIP-seq
MIRT2509483	hsa-miR-4283	CLIP-seq
MIRT2509484	hsa-miR-4284	CLIP-seq
MIRT2509485	hsa-miR-4421	CLIP-seq
MIRT2509486	hsa-miR-4436a	CLIP-seq
MIRT2509487	hsa-miR-4436b-3p	CLIP-seq
MIRT2509488	hsa-miR-4437	CLIP-seq
MIRT2509489	hsa-miR-4446-3p	CLIP-seq
MIRT2509490	hsa-miR-4447	CLIP-seq
MIRT2509491	hsa-miR-4449	CLIP-seq
MIRT2509492	hsa-miR-4472	CLIP-seq
MIRT2509493	hsa-miR-4488	CLIP-seq
MIRT2509494	hsa-miR-4489	CLIP-seq
MIRT2509495	hsa-miR-4492	CLIP-seq
MIRT2509496	hsa-miR-4498	CLIP-seq
MIRT2509497	hsa-miR-4505	CLIP-seq
MIRT2509498	hsa-miR-4517	CLIP-seq
MIRT2509499	hsa-miR-4641	CLIP-seq
MIRT2509500	hsa-miR-4652-5p	CLIP-seq
MIRT2509501	hsa-miR-4655-3p	CLIP-seq
MIRT2509502	hsa-miR-4667-5p	CLIP-seq
MIRT2509503	hsa-miR-4685-5p	CLIP-seq
MIRT2509504	hsa-miR-4697-5p	CLIP-seq
MIRT2509505	hsa-miR-4700-5p	CLIP-seq
MIRT2509506	hsa-miR-4717-5p	CLIP-seq
MIRT2509507	hsa-miR-4725-5p	CLIP-seq
MIRT2509508	hsa-miR-4726-3p	CLIP-seq
MIRT2509509	hsa-miR-4731-5p	CLIP-seq
MIRT2509510	hsa-miR-4736	CLIP-seq
MIRT2509511	hsa-miR-4740-3p	CLIP-seq
MIRT2509512	hsa-miR-4763-3p	CLIP-seq
MIRT2509513	hsa-miR-4768-3p	CLIP-seq
MIRT2509514	hsa-miR-485-5p	CLIP-seq
MIRT2509515	hsa-miR-486-3p	CLIP-seq
MIRT2509516	hsa-miR-491-5p	CLIP-seq
MIRT2509517	hsa-miR-504	CLIP-seq
MIRT2509518	hsa-miR-511	CLIP-seq
MIRT2509519	hsa-miR-513c	CLIP-seq
MIRT2509520	hsa-miR-514b-5p	CLIP-seq
MIRT911813	hsa-miR-661	CLIP-seq
MIRT2509521	hsa-miR-670	CLIP-seq
MIRT2509522	hsa-miR-762	CLIP-seq
MIRT2509523	hsa-miR-767-3p	CLIP-seq
MIRT2509524	hsa-miR-939	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	23001182
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	NAS	15664994
GO:0005130	Function	Granulocyte colony-stimulating factor receptor binding	IBA
GO:0005130	Function	Granulocyte colony-stimulating factor receptor binding	IEA
GO:0005130	Function	Granulocyte colony-stimulating factor receptor binding	TAS	2420009
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	2420009
GO:0006955	Process	Immune response	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	2420009
GO:0019221	Process	Cytokine-mediated signaling pathway	NAS	15664994
GO:0019899	Function	Enzyme binding	IPI	12393522
GO:0030838	Process	Positive regulation of actin filament polymerization	IDA	23001182
GO:0030851	Process	Granulocyte differentiation	NAS	15664994
GO:0038158	Process	Granulocyte colony-stimulating factor signaling pathway	IDA	23001182
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045471	Process	Response to ethanol	IEA
GO:0045639	Process	Positive regulation of myeloid cell differentiation	IBA
GO:0045639	Process	Positive regulation of myeloid cell differentiation	IEA
GO:0045639	Process	Positive regulation of myeloid cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	23001182
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	23001182
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	IDA	23001182
GO:0071682	Component	Endocytic vesicle lumen	IEA
GO:0071682	Component	Endocytic vesicle lumen	TAS
GO:0110053	Process	Regulation of actin filament organization	IDA	23001182

MIM	HGNC	e!Ensembl
138970	2438	ENSG00000108342

P09919

Protein name

Granulocyte colony-stimulating factor (G-CSF) (Pluripoietin) (Filgrastim) (Lenograstim)

Protein function

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophag

PDB

1CD9 , 1GNC , 1PGR , 1RHG , 2D9Q , 5GW9 , 5ZO6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16647	GCSF	51 → 202	Granulocyte colony-stimulating factor	Domain

Sequence

MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
AGGVLVASHLQSFLEVSYRVLRHLAQP

Sequence length

207

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction PI3K-Akt signaling pathway JAK-STAT signaling pathway Hematopoietic cell lineage IL-17 signaling pathway Malaria Coronavirus disease - COVID-19		Other interleukin signaling Interleukin-10 signaling

CSF3 (colony stimulating factor 3)