Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1440
Gene name Gene Name - the full gene name approved by the HGNC.	Colony stimulating factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CSF3
Synonyms (NCBI Gene) Gene synonyms aliases	C17orf33, CSF3OS, GCSF
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modifi

Show/Hide all(89)

miRTarBase ID	miRNA	Experiments
MIRT911805	hsa-miR-1254	CLIP-seq
MIRT911806	hsa-miR-1291	CLIP-seq
MIRT911807	hsa-miR-198	CLIP-seq
MIRT911808	hsa-miR-3116	CLIP-seq
MIRT911809	hsa-miR-328	CLIP-seq
MIRT911810	hsa-miR-4269	CLIP-seq
MIRT911811	hsa-miR-4645-5p	CLIP-seq
MIRT911812	hsa-miR-4673	CLIP-seq
MIRT911813	hsa-miR-661	CLIP-seq
MIRT911814	hsa-miR-1197	CLIP-seq
MIRT911815	hsa-miR-1909	CLIP-seq
MIRT911816	hsa-miR-4533	CLIP-seq
MIRT911817	hsa-miR-4747-5p	CLIP-seq
MIRT2447721	hsa-miR-1470	CLIP-seq
MIRT2447722	hsa-miR-188-3p	CLIP-seq
MIRT2447723	hsa-miR-2355-5p	CLIP-seq
MIRT2447724	hsa-miR-4469	CLIP-seq
MIRT2447725	hsa-miR-4667-3p	CLIP-seq
MIRT2447726	hsa-miR-532-3p	CLIP-seq
MIRT2509457	hsa-miR-1207-5p	CLIP-seq
MIRT2509458	hsa-miR-1236	CLIP-seq
MIRT2509459	hsa-miR-1264	CLIP-seq
MIRT2509460	hsa-miR-139-3p	CLIP-seq
MIRT2509461	hsa-miR-1825	CLIP-seq
MIRT2509462	hsa-miR-1912	CLIP-seq
MIRT2509463	hsa-miR-1915	CLIP-seq
MIRT2447723	hsa-miR-2355-5p	CLIP-seq
MIRT2509464	hsa-miR-2467-3p	CLIP-seq
MIRT2509465	hsa-miR-2467-5p	CLIP-seq
MIRT2509466	hsa-miR-3121-3p	CLIP-seq
MIRT2509467	hsa-miR-3144-5p	CLIP-seq
MIRT2509468	hsa-miR-3150a-3p	CLIP-seq
MIRT2509469	hsa-miR-3175	CLIP-seq
MIRT2509470	hsa-miR-3188	CLIP-seq
MIRT2509471	hsa-miR-3191	CLIP-seq
MIRT2509472	hsa-miR-339-5p	CLIP-seq
MIRT2509473	hsa-miR-3653	CLIP-seq
MIRT2509474	hsa-miR-3657	CLIP-seq
MIRT2509475	hsa-miR-3658	CLIP-seq
MIRT2509476	hsa-miR-3664-3p	CLIP-seq
MIRT2509477	hsa-miR-3665	CLIP-seq
MIRT2509478	hsa-miR-3677-3p	CLIP-seq
MIRT2509479	hsa-miR-3678-3p	CLIP-seq
MIRT2509480	hsa-miR-371b-3p	CLIP-seq
MIRT2509481	hsa-miR-3934	CLIP-seq
MIRT2509482	hsa-miR-3975	CLIP-seq
MIRT2509483	hsa-miR-4283	CLIP-seq
MIRT2509484	hsa-miR-4284	CLIP-seq
MIRT2509485	hsa-miR-4421	CLIP-seq
MIRT2509486	hsa-miR-4436a	CLIP-seq
MIRT2509487	hsa-miR-4436b-3p	CLIP-seq
MIRT2509488	hsa-miR-4437	CLIP-seq
MIRT2509489	hsa-miR-4446-3p	CLIP-seq
MIRT2509490	hsa-miR-4447	CLIP-seq
MIRT2509491	hsa-miR-4449	CLIP-seq
MIRT2509492	hsa-miR-4472	CLIP-seq
MIRT2509493	hsa-miR-4488	CLIP-seq
MIRT2509494	hsa-miR-4489	CLIP-seq
MIRT2509495	hsa-miR-4492	CLIP-seq
MIRT2509496	hsa-miR-4498	CLIP-seq
MIRT2509497	hsa-miR-4505	CLIP-seq
MIRT2509498	hsa-miR-4517	CLIP-seq
MIRT2509499	hsa-miR-4641	CLIP-seq
MIRT2509500	hsa-miR-4652-5p	CLIP-seq
MIRT2509501	hsa-miR-4655-3p	CLIP-seq
MIRT2509502	hsa-miR-4667-5p	CLIP-seq
MIRT2509503	hsa-miR-4685-5p	CLIP-seq
MIRT2509504	hsa-miR-4697-5p	CLIP-seq
MIRT2509505	hsa-miR-4700-5p	CLIP-seq
MIRT2509506	hsa-miR-4717-5p	CLIP-seq
MIRT2509507	hsa-miR-4725-5p	CLIP-seq
MIRT2509508	hsa-miR-4726-3p	CLIP-seq
MIRT2509509	hsa-miR-4731-5p	CLIP-seq
MIRT2509510	hsa-miR-4736	CLIP-seq
MIRT2509511	hsa-miR-4740-3p	CLIP-seq
MIRT2509512	hsa-miR-4763-3p	CLIP-seq
MIRT2509513	hsa-miR-4768-3p	CLIP-seq
MIRT2509514	hsa-miR-485-5p	CLIP-seq
MIRT2509515	hsa-miR-486-3p	CLIP-seq
MIRT2509516	hsa-miR-491-5p	CLIP-seq
MIRT2509517	hsa-miR-504	CLIP-seq
MIRT2509518	hsa-miR-511	CLIP-seq
MIRT2509519	hsa-miR-513c	CLIP-seq
MIRT2509520	hsa-miR-514b-5p	CLIP-seq
MIRT911813	hsa-miR-661	CLIP-seq
MIRT2509521	hsa-miR-670	CLIP-seq
MIRT2509522	hsa-miR-762	CLIP-seq
MIRT2509523	hsa-miR-767-3p	CLIP-seq
MIRT2509524	hsa-miR-939	CLIP-seq

Show/Hide all(36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	23001182
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	NAS	15664994
GO:0005130	Function	Granulocyte colony-stimulating factor receptor binding	IBA
GO:0005130	Function	Granulocyte colony-stimulating factor receptor binding	IEA
GO:0005130	Function	Granulocyte colony-stimulating factor receptor binding	TAS	2420009
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	2420009
GO:0006955	Process	Immune response	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	2420009
GO:0019221	Process	Cytokine-mediated signaling pathway	NAS	15664994
GO:0019899	Function	Enzyme binding	IPI	12393522
GO:0030838	Process	Positive regulation of actin filament polymerization	IDA	23001182
GO:0030851	Process	Granulocyte differentiation	NAS	15664994
GO:0038158	Process	Granulocyte colony-stimulating factor signaling pathway	IDA	23001182
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045471	Process	Response to ethanol	IEA
GO:0045639	Process	Positive regulation of myeloid cell differentiation	IBA
GO:0045639	Process	Positive regulation of myeloid cell differentiation	IEA
GO:0045639	Process	Positive regulation of myeloid cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	23001182
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	23001182
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	IDA	23001182
GO:0071682	Component	Endocytic vesicle lumen	IEA
GO:0071682	Component	Endocytic vesicle lumen	TAS
GO:0110053	Process	Regulation of actin filament organization	IDA	23001182

MIM	HGNC	e!Ensembl
138970	2438	ENSG00000108342

Protein

UniProt ID

P09919

Protein name

Granulocyte colony-stimulating factor (G-CSF) (Pluripoietin) (Filgrastim) (Lenograstim)

Protein function

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophag

PDB

1CD9 , 1GNC , 1PGR , 1RHG , 2D9Q , 5GW9 , 5ZO6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16647	GCSF	51 → 202	Granulocyte colony-stimulating factor	Domain

Sequence

MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
AGGVLVASHLQSFLEVSYRVLRHLAQP

Sequence length

207

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction PI3K-Akt signaling pathway JAK-STAT signaling pathway Hematopoietic cell lineage IL-17 signaling pathway Malaria Coronavirus disease - COVID-19		Other interleukin signaling Interleukin-10 signaling

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma, Atopic asthma	N/A	N/A	GWAS
Bipolar Disorder	Bipolar disorder	N/A	N/A	GWAS

Show/Hide Text Mining Associations (249)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Disease	Inhibit	11835352, 12676791
Acute Disease	Associate	24387791
Acute On Chronic Liver Failure	Inhibit	35651610
Adenocarcinoma	Associate	11583970
Adenocarcinoma of Lung	Associate	31004093, 35246970, 36100844
Agranulocytosis	Associate	10792393
Allergic Fungal Sinusitis	Associate	34356683
Alpha Thalassemia Myelodysplasia Syndrome	Stimulate	10887102
Alzheimer Disease	Associate	18769539
Amyotrophic Lateral Sclerosis	Stimulate	21659498
Amyotrophic Lateral Sclerosis	Inhibit	30569457
Anemia Aplastic	Associate	1375845, 16980411, 7689868, 9827895
Anemia Aplastic	Inhibit	8580564
Anemia Diamond Blackfan	Associate	12718904
Anemia Hemolytic	Inhibit	11260077
Aneuploidy	Associate	21719598
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	22403660
Aortic Aneurysm Abdominal	Associate	17321344
Arterial Occlusive Diseases	Associate	33776989
Arthralgia	Associate	37280058
Arthritis	Associate	22860122, 37280058
Arthritis Juvenile	Associate	30327490
Arthritis Rheumatoid	Associate	1372187, 28239238, 9691097
Ascites	Inhibit	21203522
Asthma	Associate	12594295, 29378629, 31744834, 34510493, 38507932
Astrocytoma	Associate	1377084
Atherosclerosis	Associate	36835545
Autoimmune Diseases	Associate	12676791
beta Thalassemia	Associate	10089916, 24001178
Blast Injuries	Associate	31621494
Bone Marrow Diseases	Stimulate	8608239
Bone Marrow Failure Disorders	Associate	12676791
Bone Resorption	Associate	37365568
Breast Neoplasms	Associate	10192440, 10473803, 15386335, 17261184, 24026883, 30778902, 30814616, 32242230
Carcinogenesis	Associate	31522450
Carcinoma	Associate	37926435
Carcinoma Giant Cell	Associate	25400792
Carcinoma Hepatocellular	Associate	37904170, 8639772
Carcinoma Ovarian Epithelial	Associate	24220695
Carcinoma Renal Cell	Associate	31366794
Carcinoma Small Cell	Associate	1689190
Carcinoma Squamous Cell	Associate	10673310
Cardiomyopathy Dilated	Associate	27025690
Cell Transformation Viral	Associate	18923646, 22371884
Cerebral Infarction	Inhibit	24387791, 25849550
Cerebral Infarction	Stimulate	31481525
Cerebrovascular Disorders	Associate	25849550
Chemical and Drug Induced Liver Injury	Inhibit	35997009
Chromosome 7 monosomy	Stimulate	16980411, 9827895
Chromosome 7 monosomy	Associate	8608239
Chromosome 8 trisomy	Associate	8608239
Chronic Disease	Associate	24489443, 26743340
Chronic Periodontitis	Associate	26211001, 30922293
Cocaine Related Disorders	Associate	34211033
Coinfection	Inhibit	39252295
Colitis Ulcerative	Stimulate	18160345
Colitis Ulcerative	Associate	21129005, 36860851
Colonic Neoplasms	Stimulate	25400792
Colorectal Neoplasms	Associate	15879049, 25400792, 25875151, 33606788
Coronavirus Infections	Stimulate	28103598
COVID 19	Associate	33187979, 34489933, 34582497, 34899693, 36380355
Crohn Disease	Associate	16907898, 34857759
Crohn Disease	Stimulate	18160345
Cyclic neutropenia	Inhibit	10887102
Cyclic neutropenia	Associate	11133754, 1371412, 1375103, 1692489
Cystic Fibrosis	Stimulate	18026571
Cystic Fibrosis	Associate	26022954, 26485688, 31870630
Death	Associate	33187979
Depressive Disorder Major	Associate	34211033
Desmoplastic Small Round Cell Tumor	Associate	23058034
Diabetes Mellitus	Associate	28739185
Disease Progression	Stimulate	37809107
Drug Hypersensitivity	Stimulate	15470047
Drug Hypersensitivity	Associate	33108454
Drug Related Side Effects and Adverse Reactions	Stimulate	1704940, 17220565, 7685751
Dyskeratosis Congenita	Associate	18310499
Dyskeratosis Congenita	Inhibit	9163594
Ectrodactyly	Associate	25821806
Emanuel syndrome	Stimulate	10381496
Endophthalmitis	Stimulate	30296277
Endotoxemia	Associate	9269759
Enterocolitis Neutropenic	Associate	1282277
Erysipelas	Associate	28512644
Esophageal Squamous Cell Carcinoma	Associate	10673310
Fanconi Anemia	Associate	11698271, 8781414
Febrile Neutropenia	Associate	27695085
Febrile Neutropenia	Inhibit	32020764, 36675262
Felty Syndrome	Inhibit	38478670
Fever	Stimulate	8781414
Fibrosis	Stimulate	29151327
Fibrosis	Associate	38507932
Friedreich Ataxia	Associate	35945193
Glaucoma Angle Closure	Associate	26748993
Glioblastoma	Associate	10550313, 26180083, 31282108
Glioblastoma	Stimulate	21636707
Glioma	Associate	10550313, 21636707, 22313638, 34643804
Glycogen Storage Disease	Associate	15888252, 30451720
Graft vs Host Disease	Inhibit	11698124, 11835352, 12676791, 22171570, 29801459
Graft vs Host Disease	Associate	26743340, 33777007
Granulomatosis with Polyangiitis	Stimulate	23031229
Granulomatous Disease Chronic	Associate	25143186, 8704221
Hand Dermatoses	Stimulate	38478670
Hematologic Neoplasms	Associate	33108454
Hemoglobinuria Paroxysmal	Associate	9616145
Hemolytic Uremic Syndrome	Associate	9827910
Hepatitis B	Associate	7545429
Hereditary Autoinflammatory Diseases	Stimulate	36175465
Hereditary leiomyomatosis and renal cell cancer	Associate	1632458
Histiocytoma Malignant Fibrous	Associate	7691245
HIV Infections	Associate	25821806, 9116267, 9710433
HIV Infections	Stimulate	27065342
Hodgkin Disease	Associate	1632458, 24141626, 7545429
HTLV I Infections	Associate	8896397
Hypercalcemia	Stimulate	7549149
Hypoxia	Stimulate	10880747
Hypoxia	Inhibit	25849550
Idiopathic Noncirrhotic Portal Hypertension	Associate	11874890
Immune System Diseases	Associate	30778902
Infections	Inhibit	22027004, 31652152, 8541548
Infections	Associate	26990868
Inferior Wall Myocardial Infarction	Associate	40001179
Inflammation	Inhibit	12556011, 31186414
Inflammation	Associate	12594295, 16930137, 20962773, 21659498, 23554896, 24448357, 26556395, 26990868, 27394196, 28228280, 29768624, 30180944, 30327490, 30504920, 31068249 View all (11 more)
Inflammation	Stimulate	26484354, 8639772
Intestinal Pseudo Obstruction	Associate	28323901
Laminopathies	Associate	32585971
Leukemia	Associate	10536003, 11071667, 15102480, 1688504, 1692082, 1699919, 2459093, 2473799, 30208330, 7994039, 8608239, 8639905, 8839834
Leukemia	Inhibit	11157490, 35768562
Leukemia Large Granular Lymphocytic	Associate	32710512
Leukemia Lymphocytic Chronic B Cell	Associate	15142121, 7994039, 8639905
Leukemia Lymphoma Adult T Cell	Associate	11091203, 9074411
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	10233380, 10536003, 1601991, 1692082, 1702329, 7511442, 7780147
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	2460153
Leukemia Myeloid	Associate	1373742, 1688503, 1689190, 1702329
Leukemia Myeloid	Inhibit	2439153
Leukemia Myeloid Acute	Inhibit	10225671
Leukemia Myeloid Acute	Associate	10340405, 10354136, 10887102, 10940650, 11122104, 11122117, 11290617, 15102480, 16413391, 1688720, 1698193, 1699919, 1705566, 18923646, 2018839 View all (16 more)
Leukemia Myeloid Acute	Stimulate	11071667, 12489493
Leukemia Myelomonocytic Chronic	Associate	1378916
Leukemia Promyelocytic Acute	Inhibit	10381496
Leukemia Promyelocytic Acute	Associate	10622210, 15755292, 21262770, 21283726, 2439153, 2459093, 2491776, 7511442, 8608243, 9590146
Leukemia T Cell	Stimulate	12542495
Leukocyte adhesion deficiency type 1	Associate	9473215
Leukocytosis	Stimulate	7549149
Lichen Planus Oral	Associate	7738356
Liver Cirrhosis Biliary	Associate	36159788
Liver Failure	Inhibit	21175804
Liver Failure	Associate	36159788
Lung Diseases	Associate	15972674, 38507932
Lung Injury	Associate	18353856
Lung Neoplasms	Associate	12708493, 31366794, 34498383, 36100844
Lymphoma	Associate	33108454, 9074411
Lymphoma Large B Cell Diffuse	Associate	27394196
MASS syndrome	Associate	32631368
Measles	Associate	11854931
Medulloblastoma	Associate	26311248
Meniere Disease	Stimulate	36175465
Mesothelioma Malignant	Associate	25757056, 2787682
Mucocutaneous Lymph Node Syndrome	Stimulate	10233729
Multiple Myeloma	Associate	33108454
Multiple Sclerosis	Associate	30327490
Muscular Dystrophy Duchenne	Inhibit	31001554
Mycoses	Inhibit	28346317, 32341348
Myelodysplastic Syndromes	Associate	11122117, 1698477, 8704190
Myelodysplastic Syndromes	Stimulate	12489493, 12542495, 26637693, 9827895
Myelodysplastic Syndromes	Inhibit	8943864
Myositis	Associate	39946176
Myotonic Dystrophy	Inhibit	26211001
Nasal Polyps	Associate	36211987
Neoplasm Metastasis	Associate	31522450, 37506784
Neoplasms	Associate	10550313, 10673310, 11583970, 11583982, 12358927, 16830156, 17694551, 18697197, 18728788, 22893706, 23058034, 2462944, 27487142, 27497531, 27903846 View all (16 more)
Neoplasms	Stimulate	24448357, 25400792, 31186414, 32170377
Neoplasms	Inhibit	36675262
Nervous System Diseases	Associate	24387791
Neural Tube Defects	Stimulate	8580564
Neuroblastoma	Associate	18485949
Neurocognitive Disorders	Associate	25821806
Neuromyelitis Optica	Associate	23637915
Neutropenia	Inhibit	10607719, 1692489, 18485949, 19881296, 24397109, 30451720, 33483893, 33560392, 38478670, 7535595, 8652846, 9074411
Neutropenia	Associate	11091218, 12884304, 1373092, 1721056, 22027004, 24594699, 39252295, 7510142
Neutropenia severe chronic	Inhibit	10887102, 12489493, 24997149
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	10590052, 1371412, 15813856, 16980411, 18923646, 22371884, 26193632, 26637693, 31248972, 7510142, 7514305, 7693032, 8541539
Neutropenia Severe Congenital Autosomal Recessive 3	Inhibit	10887102, 11071667, 22624626
Neutrophil Actin Dysfunction	Associate	9753058
Neutrophil Immunodeficiency Syndrome	Associate	11583970, 30778902, 31744834
Neutrophilia Hereditary	Stimulate	15386335, 7520770
Non alcoholic Fatty Liver Disease	Stimulate	29151327
Non alcoholic Fatty Liver Disease	Associate	36380355, 36835545
Obesity	Associate	20057362
Ovarian Neoplasms	Associate	24220695, 32878513
Ovarian Neoplasms	Inhibit	39609146
Overweight	Associate	20057362
Periodontitis	Associate	27531006, 37365568
Periprosthetic Fractures	Associate	29305046, 35306116
Philadelphia Chromosome	Associate	29338593
Pneumonia	Associate	12556011
Pneumonia Bacterial	Associate	12556011, 9649199
Precancerous Conditions	Stimulate	26990868
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	1378916
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	33108454
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	10460615
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11442492, 31943135
Primary Graft Dysfunction	Associate	36167867
Prostatic Neoplasms	Associate	22252524
Psoriasis	Associate	28239238
Pulmonary Disease Chronic Obstructive	Associate	12594295
Pulmonary Embolism	Stimulate	38109907
Renal Insufficiency Chronic	Stimulate	32046176
Renal Insufficiency Chronic	Associate	36860851
Reproductive Tract Infections	Associate	33875006
Respiratory Distress Syndrome	Associate	34446707
Respiratory Insufficiency	Associate	23840697, 25400792
Respiratory Tract Infections	Stimulate	28103598
Respiratory Tract Infections	Associate	39739128
Retinal Detachment	Associate	34544594
Rhegmatogenous Retinal Detachment Autosomal Dominant	Associate	32542038
Sarcoma Clear Cell	Associate	23058034
Sarcoma Ewing	Associate	17694551
Sepsis	Associate	34566996
Severe Combined Immunodeficiency	Associate	25143186, 8704221
Severe Fever with Thrombocytopenia Syndrome	Associate	37903435
Shwachman Diamond Syndrome	Inhibit	39252295
Skin Neoplasms	Associate	11583982
Small Cell Lung Carcinoma	Associate	1689190, 31366794, 32020764
Squamous Cell Carcinoma of Head and Neck	Associate	19385965, 37470590
Stomach Neoplasms	Associate	10673310, 24448357, 29567938
Stomatitis Aphthous	Stimulate	21478439
Stroke	Associate	24397109
Substance Related Disorders	Associate	34211033
Sweet Syndrome	Stimulate	38478670
Syndrome	Stimulate	23028541
Thrombocytopenia	Inhibit	8580564
Thyroid Cancer Papillary	Associate	16203990
Thyroid Carcinoma Anaplastic	Associate	7549149
Trauma Nervous System	Stimulate	23840697
Triple Negative Breast Neoplasms	Associate	32242230
Tuberculosis	Associate	28025511, 34857759
Urinary Bladder Neoplasms	Associate	10710253, 1704940, 3499191, 7515769, 9166942
Urologic Neoplasms	Associate	39739128
Uterine Cervical Neoplasms	Associate	28827632
Uveitis	Stimulate	35061677
Vasospasm Intracranial	Associate	25082408
Vitreoretinopathy Proliferative	Stimulate	32542038
Waldenstrom Macroglobulinemia	Stimulate	21921047
WHIM syndrome	Inhibit	10607719
Wounds and Injuries	Associate	25849550
Wounds and Injuries	Stimulate	31207479
X Linked Combined Immunodeficiency Diseases	Associate	11843814
X linked sideroblastic anemia	Associate	20408843

CSF3 (colony stimulating factor 3)