TTC36 (tetratricopeptide repeat domain 36)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 143941
Gene name Tetratricopeptide repeat domain 36
Gene symbol TTC36
Synonyms (NCBI Gene)
HBP21
Chromosome 11
Chromosome location 11q23.3
Summary The protein encoded by this gene has three tetratricopeptide repeats and is a chaperone for heat shock protein 70. The encoded protein may function as a tumor suppressor in hepatocellular carcinoma (HCC) since it promotes apoptosis but is downregulated in
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT042389 hsa-miR-484 CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0006570 Process Tyrosine metabolic process IBA
GO:0006570 Process Tyrosine metabolic process IEA
GO:0007613 Process Memory IEA
GO:0008542 Process Visual learning IEA
GO:0021954 Process Central nervous system neuron development IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
620701 33708 ENSG00000172425
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NLP5
Protein name Tetratricopeptide repeat protein 36 (TPR repeat protein 36) (HSP70-binding protein 21)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13424 TPR_12 83 → 153 Repeat
Sequence 
MGTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVM
AAEAGDLSTALERFGQAICLLPERASAYNNRAQARRLQGDVAGALEDLERAVELSGGRGR
AARQSFVQRGLLARLQGRDDDARRDFERAARLGSPFARRQLVLLNPYAALCNRMLADMMG
QLRRPRDSR
Sequence length 189
Interactions View interactions