Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
143941
Gene name Gene Name - the full gene name approved by the HGNC.
Tetratricopeptide repeat domain 36
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TTC36
Synonyms (NCBI Gene) Gene synonyms aliases
HBP21
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene has three tetratricopeptide repeats and is a chaperone for heat shock protein 70. The encoded protein may function as a tumor suppressor in hepatocellular carcinoma (HCC) since it promotes apoptosis but is downregulated in
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT042389 hsa-miR-484 CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0006570 Process Tyrosine metabolic process IBA
GO:0006570 Process Tyrosine metabolic process IEA
GO:0007613 Process Memory IEA
GO:0008542 Process Visual learning IEA
GO:0021954 Process Central nervous system neuron development IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
620701 33708 ENSG00000172425
Protein
UniProt ID A6NLP5
Protein name Tetratricopeptide repeat protein 36 (TPR repeat protein 36) (HSP70-binding protein 21)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13424 TPR_12 83 153 Repeat
Sequence
MGTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVM
AAEAGDLSTALERFGQAICLLPERASAYNNRAQARRLQGDVAGALEDLERAVELSGGRGR
AARQSFVQRGLLARLQGRDDDARRDFERAARLG
SPFARRQLVLLNPYAALCNRMLADMMG
QLRRPRDSR
Sequence length 189
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 35846428
Carcinoma Hepatocellular Inhibit 37120619