ARHGAP42 (Rho GTPase activating protein 42)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
143872
Gene name Gene Name - the full gene name approved by the HGNC.
Rho GTPase activating protein 42
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ARHGAP42
Synonyms (NCBI Gene) Gene synonyms aliases
AD031, GRAF3, TMEM133
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a Rho GTPase-activating protein (RhoGAP), and member of the GRAF or BAR-PH family of proteins. Expression of this gene is enriched in vascular smooth muscle cells and the encoded protein inhibits RhoA activity to regulate vascular tone a
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(313)
miRTarBase ID miRNA Experiments Reference
MIRT046977 hsa-miR-221-3p CLASH 23622248
MIRT367645 hsa-miR-138-5p PAR-CLIP 21572407
MIRT367644 hsa-miR-222-3p PAR-CLIP 21572407
MIRT046977 hsa-miR-221-3p PAR-CLIP 21572407
MIRT508071 hsa-miR-4511 PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0003085 Process Negative regulation of systemic arterial blood pressure IEA
GO:0005096 Function GTPase activator activity IBA 21873635
GO:0005096 Function GTPase activator activity IDA 24335996
GO:0005575 Component Cellular_component ND
GO:0007165 Process Signal transduction IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
615936 26545 ENSG00000165895
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID A6NI28
Protein name Rho GTPase-activating protein 42 (Rho GTPase-activating protein 10-like) (Rho-type GTPase-activating protein 42)
Protein function May influence blood pressure by functioning as a GTPase-activating protein for RHOA in vascular smooth muscle.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16746 BAR_3 6 → 249 Domain
PF00169 PH 266 → 371 PH domain Domain
PF00620 RhoGAP 396 → 549 RhoGAP domain Domain
PF14604 SH3_9 823 → 872 Variant SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly and selectively expressed in smooth muscle cells. {ECO:0000269|PubMed:24335996}.
Sequence 
MGLPTLEFSDSYLDSPDFRERLQCHEIELERTNKFIKELIKDGSLLIGALRNLSMAVQKF
SQSLQDFQFECIGDAETDDEISIAQSLKEFARLLIAVEEERRRLIQNANDVLIAPLEKFR
KEQIGAAKDGKKKFDKESEKYYSILEKHLNLSAKKKESHLQEADTQIDREHQNFYEASLE
YVFKIQEVQEKKKFEFVEPLLSFLQGLFTFYHEGYELAQEFAPYKQQLQFNLQNTRNNFE
STRQEVERLMQRMKSANQDYRPPSQWTMEGYLYVQEKRPLGFTWIKHYCTYDKGSKTFTM
SVSEMKSSGKMNGLVTSSPEMFKLKSCIRRKTDSIDKRFCFDIEVVERHGIITLQAFSEA
NRKLWLEAMDGKEPIYTLPAIISKKEEMYLNEAGFNFVRKCIQAVETRGITILGLYRIGG
VNSKVQKLMNTTFSPKSPPDIDIDIELWDNKTITSGLKNYLRCLAEPLMTYKLHKDFIIA
VKSDDQNYRVEAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTL
MRAQEETVAAMMNIKFQNIVVEILIEHYEKIFHTAPDPSIPLPQPQSRSGSRRTRAICLS
TGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTTKSASCQPREKSG
GIPWIATPSSSNGQKSLGLWTTSPESSSREDATKTDAESDCQSVASVTSPGDVSPPIDLV
KKEPYGLSGLKRASASSLRSISAAEGNKSYSGSIQSLTSVGSKETPKASPNPDLPPKMCR
RLRLDTASSNGYQRPGSVVAAKAQLFENVGSPKPVSSGRQAKAMYSCKAEHSHELSFPQG
AIFSNVYPSVEPGWLKATYEGKTGLVPENYVVFL
Sequence length 874
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Rho GTPase cycle
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Coronary artery disease Coronary Artery Disease rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537 30104761, 29212778
Hypertension Hypertensive disease rs13306026 21909115, 30487518
Show/Hide Unknown Diseases (7)
Unknown
Disease term Disease name Evidence References Source
Chronic obstructive pulmonary disease Chronic Obstructive Airway Disease 30940143 ClinVar
Asthma Asthma GWAS
Mastocytosis Mastocytosis GWAS
Myocardial Infarction Myocardial Infarction GWAS
Show/Hide Text Mining Associations (10)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 31277598
Conotruncal cardiac defects Associate 32710738
Hypertension Associate 30903111, 37175507
Nasopharyngeal Carcinoma Associate 29936709
Nasopharyngeal Neoplasms Associate 29936709
Neoplasm Metastasis Stimulate 29936709
Neoplasms Associate 29936709
Niemann Pick Disease Type C Stimulate 29936709
Pulmonary Arterial Hypertension Associate 37176017
Urinary Retention Associate 39222669