Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	1437
Gene name	Colony stimulating factor 2
Gene symbol	CSF2
Synonyms (NCBI Gene)	CSFGMCSF
Chromosome	5
Chromosome location	5q31.1
Summary	The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster o

Show/Hide all (25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT736497	hsa-miR-4697-3p	RNA-seqqRT-PCR	33045840
MIRT911706	hsa-miR-2278	CLIP-seq
MIRT911707	hsa-miR-433	CLIP-seq
MIRT911708	hsa-miR-4660	CLIP-seq
MIRT911709	hsa-miR-4712-3p	CLIP-seq
MIRT911710	hsa-miR-646	CLIP-seq
MIRT1970287	hsa-miR-133a	CLIP-seq
MIRT1970288	hsa-miR-133b	CLIP-seq
MIRT1970289	hsa-miR-1470	CLIP-seq
MIRT1970290	hsa-miR-4281	CLIP-seq
MIRT1970291	hsa-miR-4667-3p	CLIP-seq
MIRT1970287	hsa-miR-133a	CLIP-seq
MIRT1970288	hsa-miR-133b	CLIP-seq
MIRT1970289	hsa-miR-1470	CLIP-seq
MIRT2206234	hsa-miR-1915	CLIP-seq
MIRT1970290	hsa-miR-4281	CLIP-seq
MIRT2206235	hsa-miR-4436b-3p	CLIP-seq
MIRT2206236	hsa-miR-4645-5p	CLIP-seq
MIRT1970291	hsa-miR-4667-3p	CLIP-seq
MIRT2206237	hsa-miR-4673	CLIP-seq
MIRT2206238	hsa-miR-4685-5p	CLIP-seq
MIRT2206239	hsa-miR-4736	CLIP-seq
MIRT2447705	hsa-miR-3688-3p	CLIP-seq
MIRT2447706	hsa-miR-4635	CLIP-seq
MIRT2509453	hsa-miR-548c-3p	CLIP-seq

Show/Hide all (8)

Transcription factor	Regulation	Reference
CREBBP	Unknown	20439113
CTCF	Unknown	19158269
ETS1	Unknown	12475968
ETS2	Activation	12646185
JUN	Unknown	15840658
NFKB1	Unknown	18285351
RELA	Unknown	18285351
RUNX1	Unknown	20439113

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001821	Process	Histamine secretion	IEA
GO:0001892	Process	Embryonic placenta development	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	3925454, 9722506
GO:0005125	Function	Cytokine activity	IEA
GO:0005129	Function	Granulocyte macrophage colony-stimulating factor receptor binding	IEA
GO:0005129	Function	Granulocyte macrophage colony-stimulating factor receptor binding	TAS	2999978
GO:0005515	Function	Protein binding	IPI	18692472, 25416956, 25910212, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	3925454
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	NAS	1702217
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	18692472
GO:0008083	Function	Growth factor activity	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	9722506
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	10666185
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IDA	19032770
GO:0030099	Process	Myeloid cell differentiation	IBA
GO:0030223	Process	Neutrophil differentiation	IEA
GO:0030224	Process	Monocyte differentiation	IEA
GO:0030225	Process	Macrophage differentiation	IDA	24942581
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030526	Component	Granulocyte macrophage colony-stimulating factor receptor complex	IDA	27396825
GO:0032747	Process	Positive regulation of interleukin-23 production	IDA	20027291
GO:0034021	Process	Response to silicon dioxide	IEA
GO:0034405	Process	Response to fluid shear stress	IEA
GO:0038157	Process	Granulocyte-macrophage colony-stimulating factor signaling pathway	IDA	9722506, 18692472
GO:0042045	Process	Epithelial fluid transport	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0043011	Process	Myeloid dendritic cell differentiation	IDA	16116184
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0045187	Process	Regulation of circadian sleep/wake cycle, sleep	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16606666
GO:0050793	Process	Regulation of developmental process	IEA
GO:0070665	Process	Positive regulation of leukocyte proliferation	IDA	18692472
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071803	Process	Positive regulation of podosome assembly	IDA	15220135
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IDA	24942581
GO:0097028	Process	Dendritic cell differentiation	IDA	21149635
GO:0097028	Process	Dendritic cell differentiation	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	9722506
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	10666185

MIM	HGNC	e!Ensembl
138960	2434	ENSG00000164400

P04141

Protein name

Granulocyte-macrophage colony-stimulating factor (GM-CSF) (Colony-stimulating factor) (CSF) (Molgramostin) (Sargramostim)

Protein function

Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.

PDB

1CSG , 2GMF , 4NKQ , 4RS1 , 5C7X , 5D70 , 5D71 , 5D72 , 6BFQ , 6BFS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01109	GM_CSF	18 → 139	Granulocyte-macrophage colony-stimulating factor	Domain

Sequence

MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE

Sequence length

144

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway Hematopoietic cell lineage Natural killer cell mediated cytotoxicity IL-17 signaling pathway T cell receptor signaling pathway Fc epsilon RI signaling pathway TNF signaling pathway Shigellosis Amoebiasis Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Coronavirus disease - COVID-19 Transcriptional misregulation in cancer Acute myeloid leukemia Rheumatoid arthritis		Interleukin-3, Interleukin-5 and GM-CSF signaling RAF/MAP kinase cascade Interleukin-10 signaling RUNX1 regulates transcription of genes involved in differentiation of myeloid cells Interleukin receptor SHC signaling

CSF2 (colony stimulating factor 2)